PSMA3 Antikörper (AA 88-127)

Produktnummer ABIN5708104

Produktdetails anti-PSMA3 Antikörper

Target: PSMA3 (Proteasome Subunit Alpha Type 3 (PSMA3))

Bindungsspezifität: AA 88-127

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PSMA3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 88-127 (LADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYS) from the human protein were used as the immunogen for the PSMA3 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the PSMA3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu PSMA3

Target: PSMA3 (Proteasome Subunit Alpha Type 3 (PSMA3))

Andere Bezeichnung: PSMA3 (PSMA3 Produkte)

Synonyme: HC8 antikoerper, PSC3 antikoerper, Psma3l antikoerper, psma3 antikoerper, im:6909944 antikoerper, zgc:114044 antikoerper, Lmpc8 antikoerper, proteasome subunit alpha 3 antikoerper, proteasome subunit alpha 3 L homeolog antikoerper, proteasome (prosome, macropain) subunit, alpha type 3 antikoerper, PSMA3 antikoerper, Psma3 antikoerper, psma3.L antikoerper, psma3 antikoerper

Hintergrund: Proteasome subunit alpha type-3, also known as macropain subunit C8 and proteasome component C8, is a protein that in humans is encoded by the PSMA3 gene. The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Two alternative transcripts encoding different isoforms have been identified.

UniProt: P25788

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA