MST1 Antikörper

Produktnummer ABIN5693273

Produktdetails anti-MST1 Antikörper

Target: MST1 (Macrophage Stimulating 1 (Hepatocyte Growth Factor-Like) (MST1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MST1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Marke: Picoband™

Sequenz: QRSPLNDFQV LRGTELQHLL HAVVPGPWQE DVADAEE

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for MST1 detection. Tested with WB in Human,Mouse,Rat.

Immunogen: A synthetic peptide corresponding to a sequence of human MST1 (QRSPLNDFQVLRGTELQHLLHAVVPGPWQEDVADAEE).

Anwendungsinformationen

Applikationshinweise:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Application Details: Western blot, 0.1-0.5 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Details zu MST1

Target: MST1 (Macrophage Stimulating 1 (Hepatocyte Growth Factor-Like) (MST1))

Andere Bezeichnung: MST1 (MST1 Produkte)

Synonyme: D3F15S2 antikoerper, DNF15S2 antikoerper, HGFL antikoerper, MSP antikoerper, NF15S2 antikoerper, E2F2 antikoerper, D3F15S2h antikoerper, D9H3F15S2 antikoerper, DNF15S2h antikoerper, Hgfl antikoerper, HGF1/MSP antikoerper, E1A antikoerper, XHL antikoerper, d3f15s2 antikoerper, dnf15s2 antikoerper, hgfl antikoerper, msp antikoerper, mst1 antikoerper, nf15s2 antikoerper, macrophage stimulating 1 antikoerper, macrophage stimulating 1 (hepatocyte growth factor-like) antikoerper, serine/threonine kinase 4 antikoerper, macrophage stimulating 1 L homeolog antikoerper, MST1 antikoerper, Mst1 antikoerper, STK4 antikoerper, mst1.L antikoerper

Hintergrund:

Synonyms: Hepatocyte growth factor-like protein, Macrophage stimulatory protein, Macrophage-stimulating protein, MSP, Hepatocyte growth factor-like protein alpha chain, Hepatocyte growth factor-like protein beta chain, MST1, D3F15S2, DNF15S2, HGFL

Background: Macrophage-stimulating protein (MSP), also known as HLP, HGFL, or HGFLP, is a protein that in humans is encoded by the MST1 gene. The protein encoded by this gene contains four kringle domains and a serine protease domain, similar to that found in hepatic growth factor. Despite the presence of the serine protease domain, the encoded protein may not have any proteolytic activity. The receptor for this protein is RON tyrosine kinase, which upon activation stimulates ciliary motility of ciliated epithelial lung cells. This protein is secreted and cleaved to form an alpha chain and a beta chain bridged by disulfide bonds.

UniProt: P26927