LMO2 Antikörper

Produktnummer ABIN5693241

Produktdetails anti-LMO2 Antikörper

Target: LMO2 (LIM Domain Only 2 (Rhombotin-Like 1) (LMO2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LMO2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Marke: Picoband™

Sequenz: QKHFCVGDRY LLINSDIVCE QDIYEWTKIN GMI

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for LMO2 detection. Tested with WB in Human,Mouse,Rat.

Immunogen: A synthetic peptide corresponding to a sequence of human LMO2 (QKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI).

Anwendungsinformationen

Applikationshinweise:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Application Details: Western blot,0.1-0.5 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Details zu LMO2

Target: LMO2 (LIM Domain Only 2 (Rhombotin-Like 1) (LMO2))

Andere Bezeichnung: LMO2 (LMO2 Produkte)

Synonyme: Rbtn-2 antikoerper, Rbtn2 antikoerper, Rhom-2 antikoerper, Ttg2 antikoerper, RBTN2 antikoerper, RBTNL1 antikoerper, RHOM2 antikoerper, TTG2 antikoerper, wu:fc83a08 antikoerper, zgc:111930 antikoerper, LMO-2 antikoerper, lmo2-A antikoerper, xlmo2 antikoerper, rhombotin-2 antikoerper, LIM domain only 2 antikoerper, LIM domain only 2 (rhombotin-like 1) antikoerper, LIM domain only 2 S homeolog antikoerper, lmo2 antikoerper, LMO2 antikoerper, Lmo2 antikoerper, lmo2.S antikoerper

Hintergrund:

Synonyms: Rhombotin-2, Cysteine-rich protein TTG-2, LIM domain only protein 2, LMO-2, T-cell translocation protein 2, LMO2, RBTN2, RBTNL1, RHOM2, TTG2

Background: LIM domain only 2 (rhombotin-like 1), also known as LMO2, RBTNL1, RBTN2, RHOM2, LIM Domain Only Protein 2, TTG2, and T-Cell Translocation Protein 2, is a protein which in humans is encoded by the LMO2 gene. LMO2 encodes a cysteine-rich, two LIM-domain protein that is required for yolk sac erythropoiesis. The LMO2 protein has a central and crucial role in hematopoietic development and is highly conserved. The LMO2 transcription start site is located approximately 25 kb downstream from the 11p13 T-cell translocation cluster (11p13 ttc), where a number T-cell acute lymphoblastic leukemia-specific translocations occur. Alternative splicing results in multiple transcript variants encoding different isoforms.

UniProt: P25791

Pathways: Chromatin Binding