FZD3 Antikörper

Produktnummer ABIN5693226

Produktdetails anti-FZD3 Antikörper

Target: FZD3 (Frizzled Family Receptor 3 (FZD3))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FZD3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Sequenz: MPNLLNHYDQ QTAALAMEPF HPMVNLDCSR DFRPFL

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for FZD3 detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Immunogen: A synthetic peptide corresponding to a sequence of human FZD3 (MPNLLNHYDQQTAALAMEPFHPMVNLDCSRDFRPFL).

Anwendungsinformationen

Applikationshinweise:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Application Details: Western blot, 0.1-0.5 μg/mL
Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Details zu FZD3

Target: FZD3 (Frizzled Family Receptor 3 (FZD3))

Andere Bezeichnung: FZD3 (FZD3 Produkte)

Synonyme: Fz-3 antikoerper, FZ-3 antikoerper, fz3 antikoerper, Xfz3 antikoerper, frz3 antikoerper, hfz3 antikoerper, frz-3 antikoerper, frizzled3 antikoerper, frizzled-3 antikoerper, FZD3 antikoerper, AU020229 antikoerper, D930050A07Rik antikoerper, Fz3 antikoerper, fz9 antikoerper, fzd3 antikoerper, zg09 antikoerper, fzd3l antikoerper, frizzled class receptor 3 antikoerper, frizzled class receptor 3 L homeolog antikoerper, frizzled class receptor 3a antikoerper, frizzled class receptor 3b antikoerper, FZD3 antikoerper, fzd3 antikoerper, fzd3.L antikoerper, Fzd3 antikoerper, fzd3a antikoerper, fzd3b antikoerper

Hintergrund:

Synonyms: Frizzled-3, Fz-3, hFz3, FZD3

Tissue Specificity: Widely expressed. Relatively high expression in the CNS, including regions of the limbic system, in kidney, pancreas, skeletal muscle, uterus and testis.

Background: Frizzled-3 is a protein that in humans is encoded by the FZD3 gene. This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. The function of this protein is unknown, although it may play a role in mammalian hair follicle development. Alternative splicing results in multiple transcript variants. This gene is a susceptibility locus for schizophrenia.

Pathways: WNT Signalweg, Tube Formation