CCT3 Antikörper (C-Term)
-
- Target Alle CCT3 Antikörper anzeigen
- CCT3 (Chaperonin Containing TCP1, Subunit 3 (Gamma) (CCT3))
-
Bindungsspezifität
- AA 497-536, C-Term
-
Reaktivität
- Human
-
Wirt
- Maus
-
Klonalität
- Monoklonal
-
Konjugat
- Dieser CCT3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Marke
- Picoband™
- Sequenz
- EPLAVKLQTY KTAVETAVLL LRIDDIVSGH KKKGDDQSRQ
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
- Mouse IgG monoclonal antibody for CCT3 detection. Tested with WB in Human.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human CCT3 (497-536aa EPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQ), different from the related mouse and rat sequences by one amino acid.
- Klon
- 12H4
- Isotyp
- IgG1
- Top Product
- Discover our top product CCT3 Primärantikörper
-
-
- Applikationshinweise
-
Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.
Application Details: Western blot, 0.1-0.5 μg/mL
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- CCT3 (Chaperonin Containing TCP1, Subunit 3 (Gamma) (CCT3))
- Andere Bezeichnung
- CCT3 (CCT3 Produkte)
- Synonyme
- chunp6930 antikoerper, wu:fb13f04 antikoerper, wu:fb52a02 antikoerper, wu:fj48b06 antikoerper, NV18778 antikoerper, CCT-gamma antikoerper, CCTG antikoerper, PIG48 antikoerper, TCP-1-gamma antikoerper, TRIC5 antikoerper, AL024092 antikoerper, Cctg antikoerper, Tcp1-rs3 antikoerper, TriC-P5 antikoerper, chaperonin containing TCP1, subunit 3 (gamma) antikoerper, T-complex protein 1 subunit gamma antikoerper, chaperonin containing TCP1 subunit 3 L homeolog antikoerper, chaperonin containing TCP1 subunit 3 antikoerper, chaperonin containing Tcp1, subunit 3 (gamma) antikoerper, cct3 antikoerper, CC1G_11423 antikoerper, Cctgamma antikoerper, tcpg antikoerper, cct3.L antikoerper, CCT3 antikoerper, Cct3 antikoerper
- Hintergrund
-
Synonyms: T-complex protein 1 subunit gamma, TCP-1-gamma, CCT-gamma, hTRiC5, CCT3, CCTG, TRIC5
Background: T-complex protein 1 subunit gamma is a protein that in humans is encoded by the CCT3 gene. The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants have been characterized for this gene. In addition, a pseudogene of this gene has been found on chromosome 8.
- UniProt
- P49368
-