INPP5D Antikörper
-
- Target Alle INPP5D Antikörper anzeigen
- INPP5D (Inositol Polyphosphate-5-Phosphatase, 145kDa (INPP5D))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser INPP5D Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Marke
- Picoband™
- Sequenz
- NEDDKFTVQA SEGVSMRFFT KLDQLIEFYK KENMGLVTHL Q
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
- Rabbit IgG polyclonal antibody for SHIP detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Immunogen
- A synthetic peptide corresponding to a sequence of human SHIP (NEDDKFTVQASEGVSMRFFTKLDQLIEFYKKENMGLVTHLQ).
- Top Product
- Discover our top product INPP5D Primärantikörper
-
-
- Applikationshinweise
-
Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).
Application Details: Western blot,0.1-0.5 μg/mL
Immunohistochemistry(Paraffin-embedded Section),0.5-1 μg/mL - Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- INPP5D (Inositol Polyphosphate-5-Phosphatase, 145kDa (INPP5D))
- Andere Bezeichnung
- INPP5D (INPP5D Produkte)
- Synonyme
- INPP5D antikoerper, 256.t00004 antikoerper, 13.t00027 antikoerper, ship antikoerper, ship1 antikoerper, AI323613 antikoerper, SHIP antikoerper, SHIP-1 antikoerper, SHIP1 antikoerper, s-SHIP antikoerper, SIP-145 antikoerper, hp51CN antikoerper, inositol polyphosphate-5-phosphatase D antikoerper, phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 antikoerper, inositol polyphosphate 5-phosphatase antikoerper, inositol polyphosphate-5-phosphatase D L homeolog antikoerper, INPP5D antikoerper, LOC100446045 antikoerper, inpp5d antikoerper, EHI_159880 antikoerper, EHI_153490 antikoerper, inpp5d.L antikoerper, LOC100380693 antikoerper, Inpp5d antikoerper
- Hintergrund
-
Synonyms: Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1, Inositol polyphosphate-5-phosphatase of 145 kDa, SIP-145, SH2 domain-containing inositol 5'-phosphatase 1, SH2 domain-containing inositol phosphatase 1, SHIP-1, p150Ship, hp51CN, INPP5D, SHIP, SHIP1
Tissue Specificity: Specifically expressed in immune and hematopoietic cells. Expressed in bone marrow and blood cells. Levels vary considerably within this compartment. Present in at least 74 % of immature CD34+ cells, whereas within the more mature population of CD33+ cells, it is present in only 10 % of cells. Present in the majority of T-cells, while it is present in a minority of B-cells (at protein level).
Background: Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 is an enzyme that in humans is encoded by the INPP5D gene. This gene is a member of the inositol polyphosphate-5-phosphatase (INPP5) family and encodes a protein with an N-terminal SH2 domain, an inositol phosphatase domain, and two C-terminal protein interaction domains. Expression of this protein is restricted to hematopoietic cells where its movement from the cytosol to the plasma membrane is mediated by tyrosine phosphorylation. At the plasma membrane, the protein hydrolyzes the 5' phosphate from phosphatidylinositol (3,4,5)-trisphosphate and inositol-1,3,4,5-tetrakisphosphate, thereby affecting multiple signaling pathways. The protein is also partly localized to the nucleus, where it may be involved in nuclear inositol phosphate signaling processes. Overall, the protein functions as a negative regulator of myeloid cell proliferation and survival. Mutations in this gene are associated with defects and cancers of the immune system.
- UniProt
- Q92835
- Pathways
- T-Zell Rezeptor Signalweg, BCR Signaling, Warburg Effekt
-