DC-SIGN/CD209 Antikörper

Produktnummer ABIN5693101

Produktdetails anti-DC-SIGN/CD209 Antikörper

Target: DC-SIGN/CD209 (CD209) (CD209)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DC-SIGN/CD209 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Immunohistochemistry (Frozen Sections) (IHC (fro))

Marke: Picoband™

Sequenz: MSDSKEPRLQ QLGLLEEEQL RGLGFRQTRG YKSLA

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for DC-SIGN detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human,Mouse,Rat.

Immunogen: A synthetic peptide corresponding to a sequence of human DC-SIGN (MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLA).

Anwendungsinformationen

Applikationshinweise:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P), IHC(F) and ICC.

Application Details: Western blot, 0.1-0.5 μg/mL
Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL
Immunohistochemistry(Frozen Section), 0.5-1 μg/mL, Human
Immunocytochemistry, 0.5-1 μg/mL, Human
Flow Cytometry, 1-3 μg/1x10⁶ cells, Human

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Details zu DC-SIGN/CD209

Target: DC-SIGN/CD209 (CD209) (CD209)

Andere Bezeichnung: CD209 (CD209 Produkte)

Synonyme: CDSIGN antikoerper, CLEC4L antikoerper, DC-SIGN antikoerper, DC-SIGN1 antikoerper, cd209 antikoerper, CLEC4M antikoerper, si:ch211-224h1.3 antikoerper, CD209 antikoerper, CIRE antikoerper, Dcsign antikoerper, SIGN-R1 antikoerper, SIGNR5 antikoerper, Cd209 antikoerper, CD209 molecule antikoerper, CD209a antigen antikoerper, CD209 antigen-like protein D antikoerper, CD209c molecule antikoerper, CD209 antigen antikoerper, CD209 antikoerper, cd209 antikoerper, Cd209a antikoerper, LOC100529184 antikoerper, Cd209c antikoerper, LOC100460708 antikoerper, LOC105484282 antikoerper

Hintergrund:

Synonyms: CD209 antigen, C-type lectin domain family 4 member L, Dendritic cell-specific ICAM-3-grabbing non-integrin 1, DC-SIGN, DC-SIGN1, CD209, CD209, CLEC4L

Tissue Specificity: Predominantly expressed in dendritic cells and in DC-residing tissues. Also found in placental macrophages, endothelial cells of placental vascular channels, peripheral blood mononuclear cells, and THP-1 monocytes.

Background: DC-SIGN (Dendritic Cell-Specific Intercellular adhesion molecule-3-Grabbing Non-integrin) also known as CD209 (Cluster of Differentiation 209) is a protein which in humans is encoded by the CD209 gene. This gene encodes a transmembrane receptor and is often referred to as DC-SIGN because of its expression on the surface of dendritic cells and macrophages. The encoded protein is involved in the innate immune system and recognizes numerous evolutionarily divergent pathogens ranging from parasites to viruses with a large impact on public health. The protein is organized into three distinct domains: an N-terminal transmembrane domain, a tandem-repeat neck domain and C-type lectin carbohydrate recognition domain. The extracellular region consisting of the C-type lectin and neck domains has a dual function as a pathogen recognition receptor and a cell adhesion receptor by binding carbohydrate ligands on the surface of microbes and endogenous cells. The neck region is important for homo-oligomerization which allows the receptor to bind multivalent ligands with high avidity. Variations in the number of 23 amino acid repeats in the neck domain of this protein are rare but have a significant impact on ligand binding ability. This gene is closely related in terms of both sequence and function to a neighboring gene. DC-SIGN and L-SIGN differ in their ligand-binding properties and distribution. Alternative splicing results in multiple variants.