HTRA1 Antikörper
-
- Target Alle HTRA1 Antikörper anzeigen
- HTRA1 (HtrA Serine Peptidase 1 (HTRA1))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HTRA1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Sequenz
- QLRAASRRSE RLHRPPVIVL QRGACGQGQE DPNSLRHKYN FIAD
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
- Rabbit IgG polyclonal antibody for HTRA1 detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Immunogen
- A synthetic peptide corresponding to a sequence of human HTRA1 (QLRAASRRSERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIAD).
- Top Product
- Discover our top product HTRA1 Primärantikörper
-
-
- Applikationshinweise
-
Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.
Application Details: Western blot, 0.1-0.5 μg/mL
Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL - Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- HTRA1 (HtrA Serine Peptidase 1 (HTRA1))
- Andere Bezeichnung
- HTRA1 (HTRA1 Produkte)
- Synonyme
- htra1 antikoerper, zgc:92029 antikoerper, zgc:172061 antikoerper, l56 antikoerper, htra antikoerper, Xhtra1 antikoerper, prss11 antikoerper, MGC145723 antikoerper, ARMD7 antikoerper, CARASIL antikoerper, HtrA antikoerper, L56 antikoerper, ORF480 antikoerper, PRSS11 antikoerper, AI429470 antikoerper, HTRA antikoerper, Prss11 antikoerper, RSPP11 antikoerper, HTRA1 antikoerper, HtrA serine peptidase 1a antikoerper, HtrA serine peptidase 1 antikoerper, HtrA serine peptidase 1b antikoerper, Serine protease HTRA1 antikoerper, HtrA serine peptidase 1 S homeolog antikoerper, htra1a antikoerper, HTRA1 antikoerper, htra1b antikoerper, htra1 antikoerper, Htra1 antikoerper, htra1.S antikoerper
- Hintergrund
-
Synonyms: Serine protease HTRA1, High-temperature requirement A serine peptidase 1, L56, Serine protease 11, HTRA1, HTRA, PRSS11
Tissue Specificity: Widely expressed, with strongest expression in placenta (at protein level). Secreted by synovial fibroblasts. Up- regulated in osteoarthritis and rheumatoid arthritis synovial fluids and cartilage as compared with non-arthritic (at protein level).
Background: Serine protease HTRA1 is an enzyme that in humans is encoded by the HTRA1 gene. This gene encodes a member of the trypsin family of serine proteases. This protein is a secreted enzyme that is proposed to regulate the availability of insulin-like growth factors (IGFs) by cleaving IGF-binding proteins. It has also been suggested to be a regulator of cell growth. Variations in the promoter region of this gene are the cause of susceptibility to age-related macular degeneration type 7.
- UniProt
- Q92743
- Pathways
- Growth Factor Binding
-