PIAS3 Antikörper
-
- Target Alle PIAS3 Antikörper anzeigen
- PIAS3 (Protein Inhibitor of Activated STAT, 3 (PIAS3))
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PIAS3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Marke
- Picoband™
- Sequenz
- QRFEEAHFTF ALTPQQVQQI LTSREVLPGA KCDYTIQVQL RF
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
- Rabbit IgG polyclonal antibody for PIAS3 detection. Tested with WB in Human,Mouse,Rat.
- Immunogen
- A synthetic peptide corresponding to a sequence of human PIAS3 (QRFEEAHFTFALTPQQVQQILTSREVLPGAKCDYTIQVQLRF).
- Top Product
- Discover our top product PIAS3 Primärantikörper
-
-
- Applikationshinweise
-
Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.
Application Details: Western blot, 0.1-0.5 μg/mL
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- PIAS3 (Protein Inhibitor of Activated STAT, 3 (PIAS3))
- Andere Bezeichnung
- PIAS3 (PIAS3 Produkte)
- Synonyme
- PIAS3 antikoerper, Pias3l antikoerper, ZMIZ5 antikoerper, protein inhibitor of activated STAT 3 antikoerper, protein inhibitor of activated STAT, 3 antikoerper, protein inhibitor of activated STAT 3 L homeolog antikoerper, PIAS3 antikoerper, pias3 antikoerper, Pias3 antikoerper, pias3.L antikoerper
- Hintergrund
-
Synonyms: E3 SUMO-protein ligase PIAS3, Protein inhibitor of activated STAT protein 3, PIAS3
Tissue Specificity: Widely expressed.
Background: E3 SUMO-protein ligase PIAS3 is an enzyme that in humans is encoded by the PIAS3 gene. This gene encodes a member of the PIAS [protein inhibitor of activated STAT (signal transducer and activator of transcription)] family of transcriptional modulators. The protein functions as a SUMO (small ubiquitin-like modifier)-E3 ligase which catalyzes the covalent attachment of a SUMO protein to specific target substrates. It directly binds to several transcription factors and either blocks or enhances their activity. Alternatively spliced transcript variants of this gene have been identified, but the full-length nature of some of these variants has not been determined.
- UniProt
- Q9Y6X2
- Pathways
- JAK-STAT Signalweg
-