CHRNA5 Antikörper (AA 44-76)

Produktnummer ABIN5647951

Produktdetails anti-CHRNA5 Antikörper

Target: CHRNA5 (Cholinergic Receptor, Nicotinic, alpha 5 (Neuronal) (CHRNA5))

Bindungsspezifität: AA 44-76

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CHRNA5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 44-76 (AKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKF) from the human protein were used as the immunogen for the CHRNA5 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the CHRNA5 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the CHRNA5 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu CHRNA5

Target: CHRNA5 (Cholinergic Receptor, Nicotinic, alpha 5 (Neuronal) (CHRNA5))

Andere Bezeichnung: CHRNA5 (CHRNA5 Produkte)

Synonyme: zgc:110642 antikoerper, LNCR2 antikoerper, Acra-5 antikoerper, Acra5 antikoerper, cholinergic receptor, nicotinic, alpha 5 antikoerper, cholinergic receptor nicotinic alpha 5 subunit antikoerper, cholinergic receptor nicotinic alpha 5 subunit L homeolog antikoerper, cholinergic receptor, nicotinic, alpha polypeptide 5 antikoerper, chrna5 antikoerper, CHRNA5 antikoerper, chrna5.L antikoerper, Chrna5 antikoerper

Hintergrund: Neuronal acetylcholine receptor subunit alpha-5 is a protein that in humans is encoded by the CHRNA5 gene. It is mapped to 15q25.1. The protein encoded by this gene is a nicotinic acetylcholine receptor subunit and a member of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. These receptors are thought to be heteropentamers composed of separate but similar subunits. Defects in this gene have been linked to susceptibility to lung cancer type 2 (LNCR2).

UniProt: P30532