CDC20 Antikörper

Produktnummer ABIN5647763

Produktdetails anti-CDC20 Antikörper

Target: CDC20 (Cell Division Cycle 20 Homolog (S. Cerevisiae) (CDC20))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CDC20 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids QTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKAT were used as the immunogen for the Cdc20 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the Cdc20 antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the Cdc20 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu CDC20

Target: CDC20 (Cell Division Cycle 20 Homolog (S. Cerevisiae) (CDC20))

Andere Bezeichnung: Cdc20 (CDC20 Produkte)

Synonyme: X-FZY antikoerper, ba276h19.3 antikoerper, cdc20a antikoerper, fizzy1 antikoerper, p55cdc antikoerper, CDC20A antikoerper, bA276H19.3 antikoerper, p55CDC antikoerper, 2310042N09Rik antikoerper, C87100 antikoerper, cell division cycle 20 antikoerper, cell division cycle 20 L homeolog antikoerper, cell division cycle 20 homolog (S. cerevisiae) antikoerper, cdc20 antikoerper, CDC20 antikoerper, cdc20.L antikoerper, Cdc20 antikoerper

Hintergrund: The cell-division cycle protein 20, also known as p55CDC, is an essential regulator of cell division that is encoded by the CDC20 gene in humans. The chromosomal assignment of human CDC20 is 1p34.2. CDC20 is a component of the mammalian cell cycle mechanism. CDC20 appears to act as a regulatory protein interacting with many other proteins at multiple points in the cell cycle. This gene's most important function is to activate the anaphase promoting complex (APC), a large 11-13 subunit complex that initiates chromatid separation and entrance into anaphase.

UniProt: Q12834