E2F4 Antikörper (AA 106-144)

Produktnummer ABIN5647555

Produktdetails anti-E2F4 Antikörper

Target: E2F4 (E2F Transcription Factor 4, P107/p130-Binding (E2F4))

Bindungsspezifität: AA 106-144

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser E2F4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 106-144 (ELQQREQELDQHKVWVQQSIRNVTEDVQNSCLAYVTHED) from the human protein were used as the immunogen for the E2F4 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the E2F4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu E2F4

Target: E2F4 (E2F Transcription Factor 4, P107/p130-Binding (E2F4))

Andere Bezeichnung: E2F4 (E2F4 Produkte)

Synonyme: E2F-4 antikoerper, 2010111M04Rik antikoerper, AI427446 antikoerper, E2F4 antikoerper, e2f-4 antikoerper, fb72f07 antikoerper, wu:fb72f07 antikoerper, wu:fe05f06 antikoerper, zgc:63815 antikoerper, E2F transcription factor 4 antikoerper, E2F transcription factor 4 S homeolog antikoerper, E2F4 antikoerper, E2f4 antikoerper, e2f4.S antikoerper, e2f4 antikoerper

Hintergrund: E2F4 is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. This protein binds to all three of the tumor suppressor proteins pRB, p107 and p130, but with higher affinity to the last two.

UniProt: Q16254

Pathways: Zellzyklus, Mitotic G1-G1/S Phases, Regulation of Cell Size