Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

DC-SIGN/CD209 Antikörper

CD209 Reaktivität: Human, Maus, Ratte WB, FACS, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
Produktnummer ABIN5647543
  • Target Alle DC-SIGN/CD209 (CD209) Antikörper anzeigen
    DC-SIGN/CD209 (CD209) (CD209)
    Reaktivität
    • 105
    • 28
    • 23
    • 1
    • 1
    Human, Maus, Ratte
    Wirt
    • 75
    • 46
    • 2
    • 1
    Kaninchen
    Klonalität
    • 74
    • 50
    Polyklonal
    Konjugat
    • 57
    • 10
    • 10
    • 7
    • 5
    • 4
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Dieser DC-SIGN/CD209 Antikörper ist unkonjugiert
    Applikation
    • 75
    • 47
    • 34
    • 34
    • 27
    • 13
    • 8
    • 7
    • 6
    • 4
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 1
    Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Aufreinigung
    Antigen affinity purified
    Immunogen
    Amino acids MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLA were used as the immunogen for the DC-SIGN antibody.
    Isotyp
    IgG
    Top Product
    Discover our top product CD209 Primärantikörper
  • Applikationshinweise
    Optimal dilution of the DC-SIGN antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL,FACS: 1-3 μg/10^6 cells
    Beschränkungen
    Nur für Forschungszwecke einsetzbar
  • Buffer
    0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
    Lagerung
    -20 °C
    Informationen zur Lagerung
    After reconstitution, the DC-SIGN antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Target
    DC-SIGN/CD209 (CD209) (CD209)
    Andere Bezeichnung
    DC-SIGN / CD209 (CD209 Produkte)
    Synonyme
    CDSIGN antikoerper, CLEC4L antikoerper, DC-SIGN antikoerper, DC-SIGN1 antikoerper, cd209 antikoerper, CLEC4M antikoerper, si:ch211-224h1.3 antikoerper, CD209 antikoerper, CIRE antikoerper, Dcsign antikoerper, SIGN-R1 antikoerper, SIGNR5 antikoerper, Cd209 antikoerper, CD209 molecule antikoerper, CD209a antigen antikoerper, CD209 antigen-like protein D antikoerper, CD209c molecule antikoerper, CD209 antigen antikoerper, CD209 antikoerper, cd209 antikoerper, Cd209a antikoerper, LOC100529184 antikoerper, Cd209c antikoerper, LOC100460708 antikoerper, LOC105484282 antikoerper
    Hintergrund
    DC-SIGN (Dendritic Cell-Specific Intercellular adhesion molecule-3-Grabbing Non-integrin) also known as CD209 (Cluster of Differentiation 209) is a protein which in humans is encoded by the CD209 gene. This gene encodes a transmembrane receptor and is often referred to as DC-SIGN because of its expression on the surface of dendritic cells and macrophages. The encoded protein is involved in the innate immune system and recognizes numerous evolutionarily divergent pathogens ranging from parasites to viruses with a large impact on public health. The protein is organized into three distinct domains: an N-terminal transmembrane domain, a tandem-repeat neck domain and C-type lectin carbohydrate recognition domain. The extracellular region consisting of the C-type lectin and neck domains has a dual function as a pathogen recognition receptor and a cell adhesion receptor by binding carbohydrate ligands on the surface of microbes and endogenous cells. The neck region is important for homo-oligomerization which allows the receptor to bind multivalent ligands with high avidity. Variations in the number of 23 amino acid repeats in the neck domain of this protein are rare but have a significant impact on ligand binding ability. This gene is closely related in terms of both sequence and function to a neighboring gene. DC-SIGN and L-SIGN differ in their ligand-binding properties and distribution. Alternative splicing results in multiple variants.
    UniProt
    Q9NNX6
Sie sind hier:
Kundenservice