ANGPTL2 Antikörper (AA 275-312)

Produktnummer ABIN5647463

Produktdetails anti-ANGPTL2 Antikörper

Target: ANGPTL2 (Angiopoietin-Like 2 (ANGPTL2))

Bindungsspezifität: AA 275-312

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ANGPTL2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 275-312 (WRDCLQALEDGHDTSSIYLVKPENTNRLMQVWCDQRHD) from the human protein were used as the immunogen for the ANGPTL2 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the ANGPTL2 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the ANGPTL2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu ANGPTL2

Target: ANGPTL2 (Angiopoietin-Like 2 (ANGPTL2))

Andere Bezeichnung: ANGPTL2 (ANGPTL2 Produkte)

Synonyme: ARP2 antikoerper, HARP antikoerper, AI593246 antikoerper, AW260363 antikoerper, Arp2 antikoerper, ANGPTL2 antikoerper, angptl2 antikoerper, wu:fc41g02 antikoerper, arp2 antikoerper, fbnl antikoerper, harp antikoerper, angptl2a antikoerper, angiopoietin like 2 antikoerper, angiopoietin-like 2 antikoerper, angiopoietin-like 2b antikoerper, angiopoietin like 2 L homeolog antikoerper, ANGPTL2 antikoerper, Angptl2 antikoerper, angptl2b antikoerper, angptl2 antikoerper, angptl2.L antikoerper

Hintergrund: Angiopoietin-related protein 2, also known as Angiopoietin-like protein 2, is a protein that in humans is encoded by the ANGPTL2 gene. Angiopoietins are members of the vascular endothelial growth factor family and the only known growth factors largely specific for vascular endothelium. Angiopoietin-1, angiopoietin-2, and angiopoietin-4 participate in the formation of blood vessels. ANGPTL2 protein is a secreted glycoprotein with homology to the angiopoietins and may exert a function on endothelial cells through autocrine or paracrine action.

UniProt: Q9UKU9