AKR1B10 Antikörper (AA 285-316)

Produktnummer ABIN5647462

Produktdetails anti-AKR1B10 Antikörper

Target: AKR1B10 (Aldo-Keto Reductase Family 1, Member B10 (Aldose Reductase) (AKR1B10))

Bindungsspezifität: AA 285-316

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AKR1B10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 285-316 (EMATILSFNRNWRACNVLQSSHLEDYPFNAEY) from the human protein were used as the immunogen for the AKR1B10 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the AKR1B10 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the AKR1B10 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu AKR1B10

Target: AKR1B10 (Aldo-Keto Reductase Family 1, Member B10 (Aldose Reductase) (AKR1B10))

Andere Bezeichnung: AKR1B10 (AKR1B10 Produkte)

Synonyme: AKR1B11 antikoerper, AKR1B12 antikoerper, ALDRLn antikoerper, ARL-1 antikoerper, ARL1 antikoerper, HIS antikoerper, HSI antikoerper, 2310005E10Rik antikoerper, Akr1b16 antikoerper, AKR antikoerper, AKR1B10 antikoerper, Akr1b10 antikoerper, aldo-keto reductase family 1 member B10 antikoerper, aldo-keto reductase family 1, member B10 (aldose reductase) antikoerper, aldo-keto reductase family 1 member B10-like 2 antikoerper, AKR1B10 antikoerper, Akr1b10 antikoerper, AKR1B10L2 antikoerper, LOC100585902 antikoerper, LOC100723118 antikoerper, LOC101107697 antikoerper

Hintergrund: Aldo-keto reductase family 1 member B10 is an enzyme that in humans is encoded by the AKR1B10 gene. This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis.

UniProt: O60218