ABCA4 Antikörper (AA 1890-1927)

Produktnummer ABIN5647438

Produktdetails anti-ABCA4 Antikörper

Target: ABCA4 (ATP-Binding Cassette, Sub-Family A (ABC1), Member 4 (ABCA4))

Bindungsspezifität: AA 1890-1927

Reaktivität: Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ABCA4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Kreuzreaktivität (Details): Expected species reactivity: Human

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 1890-1927 (FLLTLLVQRHFFLSQWIAEPTKEPIVDEDDDVAEERQR) from the human protein were used as the immunogen for the ABCA4 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the ABCA4 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the ABCA4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu ABCA4

Target: ABCA4 (ATP-Binding Cassette, Sub-Family A (ABC1), Member 4 (ABCA4))

Andere Bezeichnung: ABCA4 (ABCA4 Produkte)

Synonyme: ABC10 antikoerper, ABCR antikoerper, ARMD2 antikoerper, CORD3 antikoerper, FFM antikoerper, RMP antikoerper, RP19 antikoerper, STGD antikoerper, STGD1 antikoerper, AW050280 antikoerper, Abc10 antikoerper, Abcr antikoerper, D430003I15Rik antikoerper, RmP antikoerper, abcr antikoerper, ffm antikoerper, rmp antikoerper, rp19 antikoerper, stgd antikoerper, abc10 antikoerper, armd2 antikoerper, cord3 antikoerper, stgd1 antikoerper, zgc:91823 antikoerper, ATP binding cassette subfamily A member 4 antikoerper, ATP-binding cassette, sub-family A (ABC1), member 4 antikoerper, ATP binding cassette subfamily A member 4 L homeolog antikoerper, ATP-binding cassette, sub-family A (ABC1), member 4a antikoerper, ABCA4 antikoerper, Abca4 antikoerper, abca4 antikoerper, abca4.L antikoerper, abca4a antikoerper

Hintergrund: ABCA4 (ATP-Binding Cassette, Subfamily A, Member 4), also known as ABCR, is a protein which in humans is encoded by the ABCA4 gene. ABCA4 is a member of the ATP-binding cassette transporter gene sub-family A (ABC1) found exclusively in multicellular eukaryotes. Using a whole genome radiation hybrid panel, this gene is mapped to 1p21-p13. And this gene is expressed exclusively in retina photoreceptor cells, indicating the gene product mediates transport of an essental molecule across the photoreceptor cell membrane. Additionally, it is showed by immunofluorescence microscopy and Western blot analysis that ABCR is present in foveal and peripheral cone, as well as rod, photoreceptors. The results suggested that the loss in central vision experienced by patients with Stargardt macular dystrophy arises directly from ABCR-mediated foveal cone degeneration.

UniProt: P78363