Telefon:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antikoerper-online.de

Prospero Homeobox 2 (PROX2) Antikörper Primary Antibody

PROX2 Reaktivität: Human IHC (p) Wirt: Kaninchen Polyclonal unconjugated
Produktnummer ABIN5586253
$737.33
Zzgl. Versandkosten $45.00
100 μL
local_shipping Lieferung nach: Vereinigte Staaten von Amerika
Lieferung in 11 bis 12 Werktagen
  • Target
    Prospero Homeobox 2 (PROX2)
    Reaktivität
    Human
    • 16
    • 1
    • 1
    Wirt
    Kaninchen
    • 17
    Klonalität
    Polyklonal
    • 17
    Konjugat
    Unkonjugiert
    • 5
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    Applikation
    Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    • 17
    • 14
    • 14
    • 1
    • 1
    Verwendungszweck
    Rabbit polyclonal antibody raised against recombinant PROX2.
    Kreuzreaktivität
    Human
    Immunogen

    immunogen: Recombinant protein corresponding to amino acids of human PROX2.

    Immunogen Sequence: VLLDPPGHLTQLGRSFQGQVAEGRSEPSPPVGGACKDPLALAALPRRVQLQAGVPVGNLSLAKRLDSPRYPIPPRMTPKPCQDP

    Isotyp
    IgG
  • Applikationshinweise
    Immunohistochemistry (1:200-1:500)
    The optimal working dilution should be determined by the end user.
    Beschränkungen
    Nur für Forschungszwecke einsetzbar
  • Format
    Liquid
    Buffer
    In PBS, pH 7.2 (40 % glycerol, 0.02 % sodium azide)
    Konservierungsmittel
    Sodium azide
    Vorsichtsmaßnahmen
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Lagerung
    4 °C,-20 °C
    Informationen zur Lagerung
    Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Target
    Prospero Homeobox 2 (PROX2)
    Andere Bezeichnung
    PROX2 (PROX2 Antibody Abstract)
    Synonyme
    RGD1310315, 1700058C01Rik, PROX-2, prospero homeobox 2, Prox2, PROX2, prox2
    Hintergrund
    Full Gene Name: prospero homeobox 2
    Synonyms: FLJ36749
    Gen-ID
    283571
    UniProt
    Q3B8N5
Sie sind hier:
help Kundenservice