Germinal Center Expressed Transcript 2 (GCET2) Antikörper

Details zu Produkt Nr. ABIN5578673
Antigen
Reaktivität
Human
44
1
1
Wirt
Kaninchen
34
10
Klonalität
Polyklonal
Konjugat
Unkonjugiert
3
2
2
2
2
2
2
2
2
1
1
1
1
1
Applikation
Immunohistochemistry (IHC), Western Blotting (WB)
19
13
13
9
4
1
1
Optionen
Verwendungszweck Rabbit polyclonal antibody raised against recombinant GCET2.
Immunogen

immunogen: Recombinant protein corresponding to amino acids of human GCET2.

Immunogen Sequence: HIAEGCFCLPWKKILIFEKRQDSQNENERMSSTPIQDNVDQTYSEELCYTLINHRVLCTRPSGNSAEEYYENVPCKAERPRESLGGTETEYSLLHMPSTDPRHARSPEDEYELLMPHRISSHFL

Isotyp IgG
Kreuzreaktivität Human
Antigen
Andere Bezeichnung GCET2 (GCET2 Antibody Abstract)
Hintergrund Full Gene Name: germinal center expressed transcript 2
Synonyms: GCAT2,HGAL,MGC40441
Gen-ID 257144
Applikations-hinweise Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer In PBS, pH 7.2 (40 % glycerol, 0.02 % sodium azide).
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Bilder des Herstellers
Image no. 1 for anti-Germinal Center Expressed Transcript 2 (GCET2) antibody (ABIN5578673) Immunohistochemical staining of human tonsil with GCET2 polyclonal antibody shows cy...
Image no. 2 for anti-Germinal Center Expressed Transcript 2 (GCET2) antibody (ABIN5578673) Western blot analysis of human cell line RT-4 with GCET2 polyclonal antibody .