Thymic Stromal Lymphopoietin Antikörper
-
- Target Alle Thymic Stromal Lymphopoietin (TSLP) Antikörper anzeigen
- Thymic Stromal Lymphopoietin (TSLP)
-
Reaktivität
- Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Thymic Stromal Lymphopoietin Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for TSLP detection. Tested with WB in Mouse,Rat.
- Sequenz
- QEMAQEVQNI CLNQTSQILR LWYSFMQSPE
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for TSLP detection. Tested with WB in Mouse,Rat.
Gene Name: thymic stromal lymphopoietin
Protein Name: Thymic stromal lymphopoietin - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence of mouse TSLP (QEMAQEVQNICLNQTSQILRLWYSFMQSPE).
- Isotyp
- IgG
- Top Product
- Discover our top product TSLP Primärantikörper
-
-
- Applikationshinweise
-
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- Thymic Stromal Lymphopoietin (TSLP)
- Andere Bezeichnung
- Tslp (TSLP Produkte)
- Synonyme
- TSLP antikoerper, thymic stromal lymphopoietin antikoerper, TSLP antikoerper, Tslp antikoerper
- Hintergrund
-
Thymic stromal lymphopoietin, also called TSLP is a protein belonging to the cytokine family. This gene is mapped to 5q22.1. It encodes a hemopoietic cytokine proposed to signal through a heterodimeric receptor complex composed of the thymic stromal lymphopoietin receptor and the IL-7R alpha chain. It mainly impacts myeloid cells and induces the release of T cell-attracting chemokines from monocytes and enhances the maturation of CD11c(+) dendritic cells. The protein promotes T helper type 2(TH2) cell responses that are associated with immunity in various inflammatory diseases, including asthma, allergic inflammation and chronic obstructive pulmonary disease. The protein is therefore considered a potential therapeutic target for the treatment of such diseases.
Synonyms: Thymic stromal lymphopoietin, Thymic stroma-derived lymphopoietin, Tslp - Gen-ID
- 53603
-