IBSP Antikörper
-
- Target Alle IBSP Antikörper anzeigen
- IBSP (Integrin-Binding Sialoprotein (IBSP))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser IBSP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for IBSP detection. Tested with WB in Human,Mouse,Rat.
- Sequenz
- FSMKNLHRRV KIEDSEENGV FKYRPRYYLY KHAYFYPHLK RFPVQ
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for IBSP detection. Tested with WB in Human,Mouse,Rat.
Gene Name: integrin binding sialoprotein
Protein Name: Bone sialoprotein 2 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence of human IBSP (FSMKNLHRRVKIEDSEENGVFKYRPRYYLYKHAYFYPHLKRFPVQ).
- Isotyp
- IgG
- Top Product
- Discover our top product IBSP Primärantikörper
-
-
- Applikationshinweise
-
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
Effect of kidney-reinforcing and marrow-beneficial Chinese medicine on bone metabolism-related factors following spinal cord injury in rats." in: Experimental and therapeutic medicine, Vol. 12, Issue 1, pp. 485-491, (2016) (PubMed).
: "The osteogenic potential of mesoporous bioglasses/silk and non-mesoporous bioglasses/silk scaffolds in ovariectomized rats: in vitro and in vivo evaluation." in: PLoS ONE, Vol. 8, Issue 11, pp. e81014, (2014) (PubMed).
: "
-
Effect of kidney-reinforcing and marrow-beneficial Chinese medicine on bone metabolism-related factors following spinal cord injury in rats." in: Experimental and therapeutic medicine, Vol. 12, Issue 1, pp. 485-491, (2016) (PubMed).
-
- Target
- IBSP (Integrin-Binding Sialoprotein (IBSP))
- Andere Bezeichnung
- IBSP (IBSP Produkte)
- Synonyme
- BNSP antikoerper, BSP antikoerper, BSP-II antikoerper, SP-II antikoerper, Bsp antikoerper, BSP II antikoerper, BSPII antikoerper, Bsp2 antikoerper, IBSP antikoerper, integrin binding sialoprotein antikoerper, integrin-binding sialoprotein antikoerper, integrin-binding sialoprotein S homeolog antikoerper, IBSP antikoerper, Ibsp antikoerper, ibsp.S antikoerper, ibsp antikoerper
- Hintergrund
-
IBSP (integrin-binding sialoprotein) is also known as BSP. The protein encoded by this gene is a major structural protein of the bone matrix. Bone sialoprotein is an acidic glycoprotein of approximately 70 kD that undergoes extensive posttranslational modifications. It constitutes approximately 12 % of the noncollagenous proteins in human bone and is synthesized by skeletal-associated cell types, including hypertrophic chondrocytes, osteoblasts, osteocytes, and osteoclasts. The only extraskeletal site of its synthesis is the trophoblast. This protein binds to calcium and hydroxyapatite via its acidic amino acid clusters, and mediates cell attachment through an RGD sequence that recognizes the vitronectin receptor. The BSP gene is mapped to 4q22.1.
Synonyms: Bone sialoprotein 2, Bone sialoprotein II, BSP II, Cell-binding sialoprotein, Integrin-binding sialoprotein, IBSP, BNSP - Gen-ID
- 3381
- UniProt
- P21815
-