CD47 Antikörper

Produktnummer ABIN5518975

Produktdetails anti-CD47 Antikörper

Target: CD47

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CD47 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for CD47 detection. Tested with WB in Human.

Sequenz: KSTVPTDFSS AKIEVSQLLK GDASLKMDKS DAVSHT

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for CD47 detection. Tested with WB in Human.
Gene Name: CD47 Molecule
Protein Name: Leukocyte surface antigen CD47

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence of human CD47 (KSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHT).

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu CD47

Target: CD47

Andere Bezeichnung: CD47 (CD47 Produkte)

Synonyme: IAP antikoerper, MER6 antikoerper, OA3 antikoerper, 9130415E20Rik antikoerper, AA407862 antikoerper, AI848868 antikoerper, AW108519 antikoerper, B430305P08Rik antikoerper, Itgp antikoerper, CD47/IAP antikoerper, alkaline phosphatase, intestinal antikoerper, CD47 molecule antikoerper, CD47 antigen (Rh-related antigen, integrin-associated signal transducer) antikoerper, Cd47 molecule antikoerper, ALPI antikoerper, CD47 antikoerper, Cd47 antikoerper

Hintergrund: CD47, also known as IAP or MER6, is a transmembrane protein that in humans is encoded by the CD47 gene. CD47 gene belongs to the immunoglobulin superfamily. This gene is mapped to 3q13.12. CD47 gene encodes a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This gene has broad tissue distribution, and is reduced in expression on Rh erythrocytes.

Synonyms: Leukocyte surface antigen CD47, Antigenic surface determinant protein OA3, Integrin-associated protein, IAP, Protein MER6, CD47, CD47, MER6

Gen-ID: 961

UniProt: Q08722