RANBP2 Antikörper (C-Term)
-
- Target Alle RANBP2 Antikörper anzeigen
- RANBP2 (RAN Binding Protein 2 (RANBP2))
-
Bindungsspezifität
- AA 3018-3057, C-Term
-
Reaktivität
- Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RANBP2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for E3 SUMO-protein ligase RanBP2(RANBP2) detection. Tested with WB in Human,Mouse,Rat.
- Sequenz
- EQLAVRFKTK EVADCFKKTF EECQQNLMKL QKGHVSLAAE
- Kreuzreaktivität (Details)
-
Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities. - Produktmerkmale
-
Rabbit IgG polyclonal antibody for E3 SUMO-protein ligase RanBP2(RANBP2) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: RAN binding protein 2
Protein Name: E3 SUMO-protein ligase RanBP2 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human RanBP2 (3018-3057aa EQLAVRFKTKEVADCFKKTFEECQQNLMKLQKGHVSLAAE), different from the related mouse sequence by nine amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product RANBP2 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- RANBP2 (RAN Binding Protein 2 (RANBP2))
- Andere Bezeichnung
- RANBP2 (RANBP2 Produkte)
- Synonyme
- ANE1 antikoerper, IIAE3 antikoerper, NUP358 antikoerper, TRP1 antikoerper, TRP2 antikoerper, A430087B05Rik antikoerper, AI256741 antikoerper, RGD1560047 antikoerper, RANBP2 antikoerper, ane1 antikoerper, nup358 antikoerper, trp1 antikoerper, trp2 antikoerper, RAN binding protein 2 antikoerper, E3 SUMO-protein ligase RanBP2 antikoerper, RANBP2 antikoerper, Ranbp2 antikoerper, LOC474539 antikoerper, ranbp2 antikoerper, LOC100511376 antikoerper
- Hintergrund
-
RAN binding protein 2 (RANBP2) is protein which in humans is encoded by the RANBP2 gene. This gene encodes a very large RAN-binding protein that immunolocalizes to the nuclear pore complex. The protein is a giant scaffold and mosaic cyclophilin-related nucleoporin implicated in the Ran-GTPase cycle. And the encoded protein directly interacts with the E2 enzyme UBC9 and strongly enhances SUMO1 transfer from UBC9 to the SUMO1 target SP100. These findings place sumoylation at the cytoplasmic filaments of the nuclear pore complex and suggest that, for some substrates, modification and nuclear import are linked events. This gene is partially duplicated in a gene cluster that lies in a hot spot for recombination on chromosome 2q.
Synonyms: E3 SUMO-protein ligase RanBP2, 358 kDa nucleoporin, Nuclear pore complex protein Nup358, Nucleoporin Nup358, Ran-binding protein 2, RanBP2, p270, RANBP2, NUP358 - Gen-ID
- 5903
- UniProt
- P49792
- Pathways
- Carbohydrate Homeostasis, Regulation of Carbohydrate Metabolic Process, Protein targeting to Nucleus
-