FDCSP Antikörper (Middle Region)

Produktnummer ABIN5518833

Produktdetails anti-FDCSP Antikörper

Target: FDCSP (C4orf7) (Chromosome 4 Open Reading Frame 7 (C4orf7))

Bindungsspezifität: AA 18-51, Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FDCSP Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Follicular dendritic cell secreted peptide(FDCSP) detection. Tested with IHC-P in Human.

Sequenz: FPVSQDQERE KRSISDSDEL ASGFFVFPYP YPFR

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Follicular dendritic cell secreted peptide(FDCSP) detection. Tested with IHC-P in Human.
Gene Name: follicular dendritic cell secreted protein
Protein Name: Follicular dendritic cell secreted peptide

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human FDCSP (18-51aa FPVSQDQEREKRSISDSDELASGFFVFPYPYPFR).

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu FDCSP

Target: FDCSP (C4orf7) (Chromosome 4 Open Reading Frame 7 (C4orf7))

Andere Bezeichnung: FDCSP (C4orf7 Produkte)

Synonyme: FDC-SP antikoerper, C4orf7 antikoerper, cDNA sequence BC037156 antikoerper, follicular dendritic cell secreted protein antikoerper, BC037156 antikoerper, FDCSP antikoerper

Hintergrund: FDC-SP or follicular dendritic cell-secreted protein, is a small, secreted protein, located on chromosome 4 in humans. FDC-SP is a 68-amino acid protein containing a signal peptide at its N terminus, which is used for directing the transport of the protein. This protein specifically binds to activated B cells, and functions as a regulator of antibody responses. It is also thought to contribute to tumor metastases by promoting cancer cell migration and invasion.

Synonyms: C4orf7 | FDC-SP | FDCSP | Q8NFU4

Gen-ID: 260436