ETS1 Antikörper (N-Term)
-
- Target Alle ETS1 Antikörper anzeigen
- ETS1 (V-Ets erythroblastosis Virus E26 Oncogene Homolog 1 (Avian) (ETS1))
-
Bindungsspezifität
- AA 67-98, N-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ETS1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Protein C-ets-1(ETS1) detection. Tested with WB in Human,Mouse.
- Sequenz
- KDPRQWTETH VRDWVMWAVN EFSLKGVDFQ KF
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Protein C-ets-1(ETS1) detection. Tested with WB in Human,Mouse.
Gene Name: ETS proto-oncogene 1, transcription factor
Protein Name: Protein C-ets-1 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human ETS1 (67-98aa KDPRQWTETHVRDWVMWAVNEFSLKGVDFQKF), identical to the related mouse and rat sequences.
- Isotyp
- IgG
- Top Product
- Discover our top product ETS1 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
Luteolin Inhibits Ischemia/Reperfusion-Induced Myocardial Injury in Rats via Downregulation of microRNA-208b-3p." in: PLoS ONE, Vol. 10, Issue 12, pp. e0144877, (2016) (PubMed).
: "
-
Luteolin Inhibits Ischemia/Reperfusion-Induced Myocardial Injury in Rats via Downregulation of microRNA-208b-3p." in: PLoS ONE, Vol. 10, Issue 12, pp. e0144877, (2016) (PubMed).
-
- Target
- ETS1 (V-Ets erythroblastosis Virus E26 Oncogene Homolog 1 (Avian) (ETS1))
- Andere Bezeichnung
- ETS1 (ETS1 Produkte)
- Synonyme
- ETS-1 antikoerper, EWSR2 antikoerper, ets1a-a antikoerper, XE1-a antikoerper, X1-c-ets-1a antikoerper, ETS-1A antikoerper, ETS-1B antikoerper, TNIP1 antikoerper, c-ets-1 antikoerper, c-ets1 antikoerper, Ets-1 antikoerper, Etsoncb antikoerper, Tpl1 antikoerper, ets1 antikoerper, ets antikoerper, AI196000 antikoerper, AI448617 antikoerper, D230050P06 antikoerper, cb516 antikoerper, id:ibd1116 antikoerper, zgc:110573 antikoerper, XE1-b antikoerper, ets-1 antikoerper, ets1-B antikoerper, ETS proto-oncogene 1, transcription factor antikoerper, v-ets avian erythroblastosis virus E26 oncogene homolog 1 S homeolog antikoerper, v-ets avian erythroblastosis virus E26 oncogene homolog 1 antikoerper, v-ets erythroblastosis virus E26 oncogene homolog 1 (avian) antikoerper, E26 avian leukemia oncogene 1, 5' domain antikoerper, v-ets avian erythroblastosis virus E26 oncogene homolog 1 L homeolog antikoerper, ETS1 antikoerper, ets1.S antikoerper, Ets1 antikoerper, ets1 antikoerper, ets1.L antikoerper
- Hintergrund
-
Protein C-ets-1 is a protein that in humans is encoded by the ETS1 gene. It is mapped to 11q24.3. This gene encodes a member of the ETS family of transcription factors, which are defined by the presence of a conserved ETS DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T in target genes. These proteins function either as transcriptional activators or repressors of numerous genes, and are involved in stem cell development, cell senescence and death, and tumorigenesis.
Synonyms: ETS 1 | Ets protein | ETS1 | ETS1 protein | EWSR 2 | EWSR2 | FLJ10768 | P54 | P14921 - Gen-ID
- 2113
- UniProt
- P14921
-