DVL3 Antikörper (Middle Region)
-
- Target Alle DVL3 Antikörper anzeigen
- DVL3 (Dishevelled, Dsh Homolog 3 (Drosophila) (DVL3))
-
Bindungsspezifität
- AA 397-434, Middle Region
-
Reaktivität
- Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DVL3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Segment polarity protein dishevelled homolog DVL-3(DVL3) detection. Tested with WB in Human,Mouse,Rat.
- Sequenz
- DTERLDDFHL SIHSDMAAIV KAMASPESGL EVRDRMW
- Kreuzreaktivität (Details)
-
Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities. - Produktmerkmale
-
Rabbit IgG polyclonal antibody for Segment polarity protein dishevelled homolog DVL-3(DVL3) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: dishevelled segment polarity protein 3
Protein Name: Segment polarity protein dishevelled homolog DVL-3 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human Dishevelled 3 (397-434aa DTERLDDFHLSIHSDMAAIVKAMASPESGLEVRDRMW L), identical to the related mouse sequence.
- Isotyp
- IgG
- Top Product
- Discover our top product DVL3 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- DVL3 (Dishevelled, Dsh Homolog 3 (Drosophila) (DVL3))
- Andere Bezeichnung
- DVL3 (DVL3 Produkte)
- Synonyme
- dsh3 antikoerper, dvl3 antikoerper, wu:fb75f04 antikoerper, wu:fi22h02 antikoerper, wu:fp61b09 antikoerper, dishevelled segment polarity protein 3 L homeolog antikoerper, dishevelled segment polarity protein 3 antikoerper, dishevelled segment polarity protein 3a antikoerper, dvl3.L antikoerper, dvl3 antikoerper, DVL3 antikoerper, Dvl3 antikoerper, dvl3a antikoerper
- Hintergrund
-
Segment polarity protein dishevelled homolog DVL-3 is a protein that in humans is encoded by the DVL3 gene. It is mapped to 3q27.1. This gene is a member of a multi-gene family which shares strong similarity with the Drosophila dishevelled gene, dsh. The Drosophila dishevelled gene encodes a cytoplasmic phosphoprotein that regulates cell proliferation.
Synonyms: Dishevelled 3 | Dishevelled-3 | DSH homolog 3 | dvl3 | KIAA0208 | Q92997 - Gen-ID
- 1857
- UniProt
- Q92997
-