TNFAIP6 Antikörper (N-Term)
-
- Target Alle TNFAIP6 Antikörper anzeigen
- TNFAIP6 (Tumor Necrosis Factor-Inducible Protein 6 (TNFAIP6))
-
Bindungsspezifität
- AA 46-91, N-Term
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TNFAIP6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Tumor necrosis factor-inducible gene 6 protein(TNFAIP6) detection. Tested with WB in Human,Rat.
- Sequenz
- KYKLTYAEAK AVCEFEGGHL ATYKQLEAAR KIGFHVCAAG WMAKGR
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Tumor necrosis factor-inducible gene 6 protein(TNFAIP6) detection. Tested with WB in Human,Rat.
Gene Name: TNF alpha induced protein 6
Protein Name: Tumor necrosis factor-inducible gene 6 protein - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human TSG6 (46-91aa KYKLTYAEAKAVCEFEGGHLATYKQLEAARKIGFHVCAAGWMAKGR), different from the related mouse sequence by two amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product TNFAIP6 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- TNFAIP6 (Tumor Necrosis Factor-Inducible Protein 6 (TNFAIP6))
- Andere Bezeichnung
- TNFAIP6 (TNFAIP6 Produkte)
- Synonyme
- Tnfip6 antikoerper, TSG-6 antikoerper, Tsg6 antikoerper, TSG6 antikoerper, TNF alpha induced protein 6 antikoerper, tumor necrosis factor alpha induced protein 6 antikoerper, Tnfaip6 antikoerper, TNFAIP6 antikoerper
- Hintergrund
-
Tumor necrosis factor-inducible gene 6 protein, also known as TSG-6, is a protein that in humans is encoded by the TNFAIP6 gene. The protein encoded by this gene is a secretory protein that contains a hyaluronan-binding domain, and thus is a member of the hyaluronan-binding protein family. The hyaluronan-binding domain is known to be involved in extracellular matrix stability and cell migration. This protein has been shown to form a stable complex with inter-alpha-inhibitor (I alpha I), and thus enhance the serine protease inhibitory activity of I alpha I, which is important in the protease network associated with inflammation. This gene can be induced by proinflammatory cytokines such as tumor necrosis factor alpha and interleukin-1. Enhanced levels of this protein are found in the synovial fluid of patients with osteoarthritis and rheumatoid arthritis.
Synonyms: TNFAIP 6 | Tnfaip6 | TSG 6 | TSG-6 | P98066 - Gen-ID
- 7130
- UniProt
- P98066
-