TNF alpha Antikörper (C-Term)

Produktnummer ABIN5518792

Produktdetails anti-TNF alpha Antikörper

Target: TNF alpha (Tumor Necrosis Factor alpha (TNF alpha))

Bindungsspezifität: AA 202-235, C-Term

Reaktivität: Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TNF alpha Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Tumor necrosis factor(TNF) detection. Tested with WB in Mouse.

Sequenz: FQLEKGDQLS AEVNLPKYLD FAESGQVYFG VIAL

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Tumor necrosis factor(TNF) detection. Tested with WB in Mouse.
Gene Name: tumor necrosis factor
Protein Name: Tumor necrosis factor

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse TNF alpha (202-235aa FQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL), different from the related human sequence by five amino acids, and from the related rat sequence by three amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Referenzen für anti-TNF alpha Antikörper (ABIN5518792)

Liu, Li, Liang, Li, Jiang, Chu, Yang: "Hydrogen sulfide attenuates myocardial fibrosis in diabetic rats through the JAK/STAT signaling pathway." in: International journal of molecular medicine, Vol. 41, Issue 4, pp. 1867-1876, (2018) (PubMed).

Sun, Xue, Xue, Ren, Wu, Wang: "Acetylpuerarin protects against OGD-induced cell injury in BV2 microglia by inhibiting HMGB1 release." in: Die Pharmazie, Vol. 73, Issue 2, pp. 92-97, (2018) (PubMed).

Gu, Ding, Tang, Lei, Jiang, Xu: "A Synthesized Glucocorticoid- Induced Leucine Zipper Peptide Inhibits Retinal Müller Cell Gliosis." in: Frontiers in pharmacology, Vol. 9, pp. 331, (2018) (PubMed).

Wang, Li, Chen, Jiang, Lu, Zhao: "Hydrogen sulfide accelerates wound healing in diabetic rats." in: International journal of clinical and experimental pathology, Vol. 8, Issue 5, pp. 5097-104, (2016) (PubMed).

Pan, Wang, Pu, Yao, Wang: "Effect of Puerarin on Expression of ICAM-1 and TNF-α in Kidneys of Diabetic Rats." in: Medical science monitor : international medical journal of experimental and clinical research, Vol. 21, pp. 2134-40, (2016) (PubMed).

Chen, Wang, Li, Jiang, Lu, Zhou: "Heme Oxygenase-1 Promotes Delayed Wound Healing in Diabetic Rats." in: Journal of diabetes research, Vol. 2016, pp. 9726503, (2016) (PubMed).

Ke, Li, Chen: "Inhibition of the NMDA receptor protects the rat sciatic nerve against ischemia/reperfusion injury." in: Experimental and therapeutic medicine, Vol. 11, Issue 5, pp. 1563-1572, (2016) (PubMed).

Liu, Lv, Ning, Yang, Zhu: "Therapeutic effects of 1,25-dihydroxyvitamin D3 on diabetes-induced liver complications in a rat model." in: Experimental and therapeutic medicine, Vol. 11, Issue 6, pp. 2284-2292, (2016) (PubMed).

Li, Tan, Tong, Han, Zhang, Liu, Sun: "Pentoxifylline inhibits pulmonary inflammation induced by infrarenal aorticcross-clamping dependent of adenosine receptor A2A." in: American journal of translational research, Vol. 8, Issue 5, pp. 2210-21, (2016) (PubMed).

Zhang, Liu, Zhou, Hu, Qian: "Protective effect of eNOS overexpression against ischemia/reperfusion injury in small-for-size liver transplantation." in: Experimental and therapeutic medicine, Vol. 12, Issue 5, pp. 3181-3188, (2016) (PubMed).

Cheng, Xiao, Ainiwaer, Wang, Wu, Mao, Yang, Bao: "Molecular responses of radiation-induced liver damage in rats." in: Molecular medicine reports, Vol. 11, Issue 4, pp. 2592-600, (2015) (PubMed).

Li, Chen, Zhang, Song, Mu: "Gastrodin inhibits neuroinflammation in rotenone-induced Parkinson's disease model rats." in: Neural regeneration research, Vol. 7, Issue 5, pp. 325-31, (2015) (PubMed).

Kan, Zhou, Jin, Yang: "Effects of PDTC on NF-?B expression and apoptosis in rats with severe acute pancreatitis-associated lung injury." in: International journal of clinical and experimental medicine, Vol. 8, Issue 3, pp. 3258-70, (2015) (PubMed).

Li, Zhang, Jiang, Yin, Fan, Sun, Chen, Li, Liu: "Protective effects of thalidomide on pulmonary injuries in a rat model of paraquat intoxication." in: Journal of inflammation (London, England), Vol. 12, pp. 46, (2015) (PubMed).

Zhang, Hu, Liu, Ye, Gui, Zhou, Qi, He, Wang, Wang: "CD11b deficiency suppresses intestinal tumor growth by reducing myeloid cell recruitment." in: Scientific reports, Vol. 5, pp. 15948, (2015) (PubMed).

Ran, Ma, Liu, Tan, Liu, Lao: "Low protein diet inhibits uric acid synthesis and attenuates renal damage in streptozotocin-induced diabetic rats." in: Journal of diabetes research, Vol. 2014, pp. 287536, (2014) (PubMed).

Wang, Zhou, Chen, Zhu: "Putative role of ischemic postconditioning in a rat model of limb ischemia and reperfusion: involvement of hypoxia-inducible factor-1? expression." in: Brazilian journal of medical and biological research = Revista brasileira de pesquisas me?dicas e biolo?gicas / Sociedade Brasileira de Biofi?sica ... [et al.], Vol. 47, Issue 9, pp. 738-45, (2014) (PubMed).

Zhang, Zhang, Deng, Li, Xing, Shi, Du: "Neuroprotective effect of pretreatment with ganoderma lucidum in cerebral ischemia/reperfusion injury in rat hippocampus." in: Neural regeneration research, Vol. 9, Issue 15, pp. 1446-52, (2014) (PubMed).

Li, Qian, Ju, Wang: "Upregulation of Toll-like receptor 2 expression in colorectal cancer infected by human cytomegalovirus." in: Oncology letters, Vol. 9, Issue 1, pp. 365-370, (2014) (PubMed).

Yu, Chen, Wang, Kuang, Liu, Zhang, Du: "Neuroprotective effect of kaempferol glycosides against brain injury and neuroinflammation by inhibiting the activation of NF-?B and STAT3 in transient focal stroke." in: PLoS ONE, Vol. 8, Issue 2, pp. e55839, (2013) (PubMed).

Details zu TNF alpha

Target: TNF alpha (Tumor Necrosis Factor alpha (TNF alpha))

Andere Bezeichnung: TNF (TNF alpha Produkte)

Synonyme: DIF antikoerper, TNF-alpha antikoerper, TNFA antikoerper, TNFSF2 antikoerper, RATTNF antikoerper, Tnfa antikoerper, tnf antikoerper, TNF-a antikoerper, TNFalpha antikoerper, Tnfsf1a antikoerper, TNFa antikoerper, cTNF antikoerper, Tnf-alpha antikoerper, tnfa-like antikoerper, TNF-ALPHA antikoerper, dif antikoerper, tnfa antikoerper, xtnf antikoerper, tnfsf2 antikoerper, tnf-alpha antikoerper, Cachectin antikoerper, tumor necrosis factor antikoerper, tumor necrosis factor b (TNF superfamily, member 2) antikoerper, tumor necrosis factor alpha antikoerper, tumor necrosis factor a (TNF superfamily, member 2) antikoerper, TNF antikoerper, Tnf antikoerper, tnf antikoerper, tnfb antikoerper, tnf-alpha antikoerper, LOC103694380 antikoerper, tnfa antikoerper

Hintergrund: TNFα(Tumor Necrosis Factor alpha) gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. This cytokine is mainly secreted by macrophages. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. And this cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. Moreover, this cytokine has been implicated in a variety of diseases, including autoimmune diseases, insulin resistance, and cancer. Knockout studies in mice also suggested the neuroprotective function of this cytokine.

Synonyms: APC1 | Cachectin | C-domain 1 | C-domain 2 | ICD1 | ICD2 | P01375 | soluble form | tnf 1 | TNF a | tnf a | TNF alpha | tnf alpha kit | TNF superfamily member 2 | TNF superfamily, member 2 | tnf1 | TNFA | TNF-a | TNFA | TNFSF2 | TNFalpha | TNF-alpha | Tumor necrosis factor alpha | Tumornecrosisfactor

Gen-ID: 21926

UniProt: P06804

Pathways: NF-kappaB Signalweg, Apoptose, Caspase Kaskade in der Apoptose, TLR Signalweg, Cellular Response to Molecule of Bacterial Origin, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, Positive Regulation of Endopeptidase Activity, Hepatitis C, Protein targeting to Nucleus, Inflammasome