Iba1 Antikörper (C-Term)

Produktnummer ABIN5518728

Produktdetails anti-Iba1 Antikörper

Target: Iba1 (IBA1) (Ionized Calcium-binding Adapter Molecule 1 (IBA1))

Bindungsspezifität: AA 99-133, C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Iba1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Allograft inflammatory factor 1(AIF1) detection. Tested with WB, IHC-P in Human.

Sequenz: ETFSYPDFLR MMLGKRSAIL KMILMYEEKA REKEK

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Allograft inflammatory factor 1(AIF1) detection. Tested with WB, IHC-P in Human.
Gene Name: allograft inflammatory factor 1
Protein Name: Allograft inflammatory factor 1

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Iba1 (99-133aa ETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEK), different from the related mouse sequence by seven amino acids, and from the related rat sequence by six amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Referenzen für anti-Iba1 Antikörper (ABIN5518728)

He, Guo, Xu, Chen, Zhang, Wu, Wang: "Alkaloids from piper longum protect dopaminergic neurons against inflammation-mediated damage induced by intranigral injection of lipopolysaccharide." in: BMC complementary and alternative medicine, Vol. 16, Issue 1, pp. 412, (2017) (PubMed).

Xiao, Zhang, Zhang, Wang, Chen, Chen, Lv, Shi, Dong: "Re-infection of the prion from the scrapie‑infected cell line SMB-S15 in three strains of mice, CD1, C57BL/6 and Balb/c." in: International journal of molecular medicine, Vol. 37, Issue 3, pp. 716-26, (2016) (PubMed).

Details zu Iba1

Target: Iba1 (IBA1) (Ionized Calcium-binding Adapter Molecule 1 (IBA1))

Andere Bezeichnung: AIF1 (IBA1 Produkte)

Synonyme: AIF-1 antikoerper, IBA1 antikoerper, IRT-1 antikoerper, IRT1 antikoerper, AI607846 antikoerper, D17H6S50E antikoerper, G1 antikoerper, Iba1 antikoerper, Bart1 antikoerper, iba1 antikoerper, mrf-1 antikoerper, fa04b11 antikoerper, wu:fa04b11 antikoerper, AIF antikoerper, AIF1 antikoerper, aif1 antikoerper, allograft inflammatory factor 1 antikoerper, AIF1 antikoerper, Aif1 antikoerper, aif1 antikoerper

Hintergrund: Allograft inflammatory factor 1 (AIF-1), also known as ionized calcium-binding adapter molecule 1(IBA1), is a protein that in humans is encoded by the AIF1 gene. This gene encodes a protein that binds actin and calcium. And this gene is induced by cytokines and interferon and may promote macrophage activation and growth of vascular smooth muscle cells and T-lymphocytes. Polymorphisms in this gene may be associated with systemic sclerosis. Alternative splicing results in multiple transcript variants, but the full-length and coding nature of some of these variants is not certain.

Synonyms: AIF 1 | AIF-1 | AIF1 protein | allograft inflammatory factor 1 | G1 | IBA1 | IBA 1 | Iba1 | P55008

Gen-ID: 199

UniProt: P55008

Pathways: Smooth Muscle Cell Migration