ABCC1 Antikörper (C-Term)

Produktnummer ABIN5518718

Produktdetails anti-ABCC1 Antikörper

Target: ABCC1 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 1 (ABCC1))

Bindungsspezifität: AA 1493-1528, C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ABCC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Multidrug resistance-associated protein 1(ABCC1) detection. Tested with WB in Human.

Sequenz: DYTRVIVLDK GEIQEYGAPS DLLQQRGLFY SMAKDA

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Multidrug resistance-associated protein 1(ABCC1) detection. Tested with WB in Human.
Gene Name: ATP-binding cassette, sub-family C (CFTR/MRP), member 1
Protein Name: Multidrug resistance-associated protein 1

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human MRP1 (1493-1528aa DYTRVIVLDKGEIQEYGAPSDLLQQRGLFYSMAKDA), different from the related mouse sequence by five amino acids, and from the related rat sequence by four amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Referenzen für anti-ABCC1 Antikörper (ABIN5518718)

Duan, Di: "Acetazolamide Suppresses Multi-Drug Resistance-Related Protein 1 and P-Glycoprotein Expression by Inhibiting Aquaporins Expression in a Mesial Temporal Epilepsy Rat Model." in: Medical science monitor : international medical journal of experimental and clinical research, Vol. 23, pp. 5818-5825, (2018) (PubMed).

Chen, Wei, Cheng, Xie, Wang, Yi, Tian, Liu, Wang, Zhang: "Characteristics of doxorubicin-selected multidrug-resistant human leukemia HL-60 cells with tolerance to arsenic trioxide and contribution of leukemia stem cells." in: Oncology letters, Vol. 15, Issue 1, pp. 1255-1262, (2018) (PubMed).

Gao, Xu, Qiu: "Enhanced combination therapy effect on paclitaxel-resistant carcinoma by chloroquine co-delivery via liposomes." in: International journal of nanomedicine, Vol. 10, pp. 6615-32, (2016) (PubMed).

Zhang, Yang, Wang, Liu, Wang, Xie, Chen, Dong, Li: "Enhanced autophagy reveals vulnerability of P-gp mediated epirubicin resistance in triple negative breast cancer cells." in: Apoptosis : an international journal on programmed cell death, Vol. 21, Issue 4, pp. 473-88, (2016) (PubMed).

Details zu ABCC1

Target: ABCC1 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 1 (ABCC1))

Andere Bezeichnung: ABCC1 (ABCC1 Produkte)

Synonyme: ABC29 antikoerper, ABCC antikoerper, GS-X antikoerper, MRP antikoerper, MRP1 antikoerper, Abcc1a antikoerper, Abcc1b antikoerper, Mdrap antikoerper, Mrp1 antikoerper, Avcc1a antikoerper, Mrp antikoerper, ABCC13 antikoerper, ATP binding cassette subfamily C member 1 antikoerper, ATP-binding cassette, sub-family C (CFTR/MRP), member 1 antikoerper, multidrug resistance-associated protein 1 antikoerper, ABCC1 antikoerper, Abcc1 antikoerper, LOC100152428 antikoerper, LOC100346553 antikoerper

Hintergrund: Multidrug resistance-associated protein 1 (MRP1) is a protein that in humans is encoded by the ABCC1 gene. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra-and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a multispecific organic anion transporter, with oxidized glutatione, cysteinyl leukotrienes, and activated aflatoxin B1 as substrates. This protein also transports glucuronides and sulfate conjugates of steroid hormones and bile salts. Alternatively spliced variants of this gene have been described but their full-length nature is unknown.

Synonyms: ABCC1 | Leukotriene C transporter | Leukotriene C(4) transporter | LTC4 transporter | MRP | MRP1 | MRP-1 | P33527

Gen-ID: 4363

UniProt: P33527

Pathways: SARS-CoV-2 Protein Interaktom