ATP1A2 Antikörper

Produktnummer ABIN5515377

Produktdetails anti-ATP1A2 Antikörper

Target: ATP1A2 (ATPase, Na+/K+ Transporting, alpha 2 Polypeptide (ATP1A2))

Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Pferd, Kaninchen, Schaf, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ATP1A2 Antikörper ist unkonjugiert

Applikation: Bitte anfragen

Sequenz: ISLAYEAAES DIMKRQPRNS QTDKLVNERL ISMAYGQIGM IQALGGFFTY

Homologie: Cow: 93%, Dog: 93%, Guinea Pig: 100%, Horse: 100%, Human: 100%, Mouse: 100%, Rabbit: 93%, Rat: 100%, Sheep: 93%, Zebrafish: 86%

Aufreinigung: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence ISLAYEAAESDIMKRQPRNSQTDKLVNERLISMAYGQIGMIQALGGFFTY

Anwendungsinformationen

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: -20 °C

Informationen zur Lagerung: For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

Details zu ATP1A2

Target: ATP1A2 (ATPase, Na+/K+ Transporting, alpha 2 Polypeptide (ATP1A2))

Andere Bezeichnung: ATP1A2 (ATP1A2 Produkte)

Synonyme: C11orf29 antikoerper, TIF1D antikoerper, TIF1DELTA antikoerper, AW060654 antikoerper, Atpa-3 antikoerper, mKIAA0778 antikoerper, RATATPA2 antikoerper, FHM2 antikoerper, MHP2 antikoerper, atp1a2 antikoerper, atp[a]2 antikoerper, atpa2 antikoerper, cb702 antikoerper, fa10d04 antikoerper, fa10d05 antikoerper, wu:fa10d05 antikoerper, ATP2A antikoerper, atp1a2.L antikoerper, fhm2 antikoerper, mhp2 antikoerper, ATP1A2 antikoerper, ATP1A4 antikoerper, tripartite motif containing 66 antikoerper, ATPase, Na+/K+ transporting, alpha 2 polypeptide antikoerper, ATPase Na+/K+ transporting subunit alpha 2 antikoerper, ATPase, Na+/K+ transporting, alpha 2a polypeptide antikoerper, sodium/potassium-transporting ATPase subunit alpha-2 antikoerper, ATPase, Na+/K+ transporting, alpha 2 polypeptide S homeolog antikoerper, TRIM66 antikoerper, Atp1a2 antikoerper, ATP1A2 antikoerper, atp1a2a antikoerper, atp1a2.S antikoerper, LOC488636 antikoerper

Hintergrund: The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The catalytic subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes an alpha 2 subunit. Mutations in this gene result in familial basilar or hemiplegic migraines, and in a rare syndrome known as alternating hemiplegia of childhood.

Alias Symbols: FHM2, MHP2,

Protein Interaction Partner: UBC, LGR4, ZNRF2, ZNRF1, CAND1, CUL3, FBXO25, TPT1,

Protein Size: 1020

Gen-ID: 477

NCBI Accession: NM_000702, NP_000693

UniProt: P50993

Pathways: Thyroid Hormone Synthesis, Proton Transport, Ribonucleoside Biosynthetic Process