Telefon:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antikoerper-online.de

N-6 Adenine-Specific DNA Methyltransferase 2 (Putative) (N6AMT2) (AA 1-214) Antikörper Primary Antibody

N6AMT2 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
Produktnummer ABIN531359
$440.00
Zzgl. Versandkosten $45.00
50 μL
local_shipping Lieferung nach: Vereinigte Staaten von Amerika
Lieferung in 11 bis 12 Werktagen
  • Target
    N-6 Adenine-Specific DNA Methyltransferase 2 (Putative) (N6AMT2)
    Bindungsspezifität
    AA 1-214
    Reaktivität
    Human
    • 8
    • 1
    • 1
    Wirt
    Maus
    • 8
    Klonalität
    Polyklonal
    • 8
    Konjugat
    Unkonjugiert
    • 5
    • 1
    • 1
    • 1
    Applikation
    Western Blotting (WB)
    • 6
    • 5
    • 1
    Verwendungszweck
    Mouse polyclonal antibody raised against a full-length human LOC221143 protein.
    Marke
    MaxPab®
    Kreuzreaktivität
    Human
    Immunogen

    immunogen: LOC221143 (NP_777588.1, 1 a.a. ~ 214 a.a) full-length human protein.

    Immunogen Sequence: MSDLEDDETPQLSAHALAALQEFYAEQKQQIEPGEDDKYNIGIIEENWQLSQFWYSQETALQLAQEAIAAVGEGGRIACVSAPSVYQKLRELCRENFSIYIFEYDKRFAMYGEEFIFYDYNNPLDLPERIAAHSFDIVIADPPYLSEECLRKTSETVKYLTRGKILLCTGAIMEEQAAELLGVKMCTFVPRHTRNLANEFRCYVNYDSGLDCGI

  • Applikationshinweise
    Optimal working dilution should be determined by the investigator.
    Kommentare

    Product Quality tested by: Antibody reactive against mammalian transfected lysate.

    Beschränkungen
    Nur für Forschungszwecke einsetzbar
  • Format
    Liquid
    Buffer
    No additive
    Konservierungsmittel
    Without preservative
    Handhabung
    Aliquot to avoid repeated freezing and thawing.
    Lagerung
    -20 °C
    Informationen zur Lagerung
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    N-6 Adenine-Specific DNA Methyltransferase 2 (Putative) (N6AMT2)
    Andere Bezeichnung
    N6AMT2 (N6AMT2 Antibody Abstract)
    Synonyme
    RGD1306762, ESP13, 2510005D08Rik, AW045965, Ayu21-96, Gt(pU21)96Imeg, GtAyu21-96, EEF1A lysine methyltransferase 1, EEF1A alpha lysine methyltransferase 1, eukaryotic translation elongation factor 1 alpha lysine methyltransferase 1, EEF1A lysine methyltransferase 1 S homeolog, Eef1akmt1, EEF1AKMT1, eef1akmt1.S
    Hintergrund
    Full Gene Name: N-6 adenine-specific DNA methyltransferase 2 (putative)
    Synonyms: ESP13
    Gen-ID
    221143
    NCBI Accession
    NP_777588, NM_174928
Sie sind hier:
help Kundenservice