WNT7A Antikörper

Produktnummer ABIN4953110

Produktdetails anti-WNT7A Antikörper

Target: WNT7A (Wingless-Type MMTV Integration Site Family, Member 7A (WNT7A))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WNT7A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity

Immunogen: Amino acids YVLKDKYNEAVHVEPVRASRNKRPTFLKIKK of human WNT7A were used as the immunogen for the WNT7A antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the WNT7A antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the WNT7A antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu WNT7A

Target: WNT7A (Wingless-Type MMTV Integration Site Family, Member 7A (WNT7A))

Andere Bezeichnung: WNT7A (WNT7A Produkte)

Synonyme: wnt7a antikoerper, AI849442 antikoerper, Wnt-7a antikoerper, px antikoerper, tw antikoerper, Xwnt-7a antikoerper, wnt-7a antikoerper, wnt7a-A antikoerper, Wnt family member 7A antikoerper, wingless-type MMTV integration site family, member 7Aa antikoerper, wingless-type MMTV integration site family, member 7A antikoerper, wingless-type MMTV integration site family member 7A S homeolog antikoerper, WNT7A antikoerper, wnt7aa antikoerper, Wnt7a antikoerper, wnt7a.S antikoerper

Hintergrund: This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is involved in the development of the anterior-posterior axis in the female reproductive tract, and also plays a critical role in uterine smooth muscle pattering and maintenance of adult uterine function. Mutations in this gene are associated with Fuhrmann and Al-Awadi / Raas - Rothschild / Schinzel phocomelia syndromes.

UniProt: O00755

Pathways: WNT Signalweg, Stem Cell Maintenance, Asymmetric Protein Localization