TAP1 Antikörper

Produktnummer ABIN4952781

Produktdetails anti-TAP1 Antikörper

Target: TAP1 (Transporter 1, ATP-Binding Cassette, Sub-Family B (MDR/TAP) (TAP1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TAP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity

Immunogen: Amino acids RSFANEEGEAQKFREKLQEIKTLNQKEAVAYAVN of human TAP1 were used as the immunogen for the TAP1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the TAP1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the TAP1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu TAP1

Target: TAP1 (Transporter 1, ATP-Binding Cassette, Sub-Family B (MDR/TAP) (TAP1))

Andere Bezeichnung: TAP1 (TAP1 Produkte)

Synonyme: ABC17 antikoerper, ABCB2 antikoerper, APT1 antikoerper, D6S114E antikoerper, PSF-1 antikoerper, PSF1 antikoerper, RING4 antikoerper, TAP1*0102N antikoerper, TAP1N antikoerper, abc17 antikoerper, abcb2 antikoerper, apt1 antikoerper, psf1 antikoerper, ring4 antikoerper, tap1a antikoerper, tap1n antikoerper, Abcb2 antikoerper, Ham-1 antikoerper, Ham1 antikoerper, MTP1 antikoerper, TAP antikoerper, Tap-1 antikoerper, Y3 antikoerper, Cim antikoerper, transporter 1, ATP binding cassette subfamily B member antikoerper, transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) L homeolog antikoerper, transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) antikoerper, TAP1 antikoerper, tap1.L antikoerper, Tap1 antikoerper

Hintergrund: Transporter associated with Antigen Processing 1 is a protein that in humans is encoded by the TAP1 gene. The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. And ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is involved in the pumping of degraded cytosolic peptides across the endoplasmic reticulum into the membrane-bound compartment where class I molecules assemble. Mutations in this gene may be associated with ankylosing spondylitis, insulin-dependent diabetes mellitus, and celiac disease. Two transcript variants encoding different isoforms have been found for this gene.

UniProt: Q03518

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process