MAPK13 Antikörper

Produktnummer ABIN4952463

Produktdetails anti-MAPK13 Antikörper

Target: MAPK13 (Mitogen-Activated Protein Kinase 13 (MAPK13))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MAPK13 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity

Immunogen: Amino acids KLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL of human MAPK13/SAPK4 were used as the immunogen for the SAPK4 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the SAPK4 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the SAPK4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu MAPK13

Target: MAPK13 (Mitogen-Activated Protein Kinase 13 (MAPK13))

Andere Bezeichnung: MAPK13 / SAPK4 (MAPK13 Produkte)

Synonyme: F24B9.3 antikoerper, F24B9_3 antikoerper, MAPK 13 antikoerper, MAPK-13 antikoerper, PRKM13 antikoerper, SAPK4 antikoerper, p38delta antikoerper, Serk4 antikoerper, Prkm13 antikoerper, sapk4 antikoerper, prkm13 antikoerper, Protein kinase superfamily protein antikoerper, mitogen-activated protein kinase 13 antikoerper, mitogen activated protein kinase 13 antikoerper, ATMPK13 antikoerper, MAPK13 antikoerper, Mapk13 antikoerper, mapk13 antikoerper

Hintergrund: MAPK13 (Mitogen-Activated Protein Kinase 13), also called p38-DELTA or Stress-Activated Protein Kinase 4 (SAPK4), is an enzyme that in humans is encoded by the MAPK13 gene. The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is closely related to p38 MAP kinase, both of which can be activated by proinflammatory cytokines and cellular stress. MAP kinase kinases 3, and 6 can phosphorylate and activate this kinase. Transcription factor ATF2, and microtubule dynamics regulator stathmin have been shown to be the substrates of this kinase.

UniProt: O15264

Pathways: MAPK Signalweg, Neurotrophin Signalübertragung, Hepatitis C, BCR Signaling, S100 Proteine