NR3C2 Antikörper

Produktnummer ABIN4951773

Produktdetails anti-NR3C2 Antikörper

Target: NR3C2 (Nuclear Receptor Subfamily 3, Group C, Member 2 (NR3C2))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NR3C2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity

Immunogen: Amino acids HALKVEFPAMLVEIISDQLPKVESGNAKPLYFHRK of the human protein were used as the immunogen for the MR antibody. This sequence is common to isoforms 1, 3 and 4.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the MR antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the MR antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu NR3C2

Target: NR3C2 (Nuclear Receptor Subfamily 3, Group C, Member 2 (NR3C2))

Andere Bezeichnung: Mineralocorticoid Receptor / MR (NR3C2 Produkte)

Synonyme: mr antikoerper, si:ch211-189l17.1 antikoerper, LOC100302443 antikoerper, NR3C2 antikoerper, LOC443144 antikoerper, MLR antikoerper, MR antikoerper, MCR antikoerper, NR3C2VIT antikoerper, Mlr antikoerper, mlr antikoerper, nuclear receptor subfamily 3, group C, member 2 antikoerper, nuclear receptor subfamily 3 group C member 2 antikoerper, mineralocorticoid receptor antikoerper, nuclear receptor subfamily 3 group C member 2 L homeolog antikoerper, nr3c2 antikoerper, NR3C2 antikoerper, LOC443144 antikoerper, Nr3c2 antikoerper, nr3c2.L antikoerper

Hintergrund: NR3C2 (nuclear receptor subfamily 3, group C, member 2), also known as MR (mineralocorticoid receptor), is a protein that in humans is encoded by the NR3C2 gene that is located on chromosome 4q31.1-31.2. It belongs to the nuclear receptor family where the ligand diffuses into cells, interacts with the receptor and results in a signal transduction affecting specific gene expression in the nucleus. This gene encodes the mineralocorticoid receptor, which mediates aldosterone actions on salt and water balance within restricted target cells. The protein functions as a ligand-dependent transcription factor that binds to mineralocorticoid response elements in order to transactivate target genes. Mutations in this gene cause autosomal dominant pseudohypoaldosteronism type I, a disorder characterized by urinary salt wasting. Defects in this gene are also associated with early onset hypertension with severe exacerbation in pregnancy. Alternative splicing results in multiple transcript variants.

UniProt: P08235

Pathways: ACE Inhibitor Pathway, Nuclear Receptor Transcription Pathway, Intracellular Steroid Hormone Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway