MDM4-binding Protein Antikörper

Produktnummer ABIN4951699

Produktdetails anti-MDM4-binding Protein Antikörper

Target: MDM4-binding Protein (MDM4) (Mdm4-binding Protein (MDM4))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MDM4-binding Protein Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity

Immunogen: Amino acids KILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQH of human MDM4 were used as the immunogen for the MDM4 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the MDM4 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the MDM4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu MDM4-binding Protein

Target: MDM4-binding Protein (MDM4) (Mdm4-binding Protein (MDM4))

Andere Bezeichnung: MDM4 / MDMX (MDM4 Produkte)

Synonyme: mdmx antikoerper, HDMX antikoerper, MDMX antikoerper, MRP1 antikoerper, wu:fa09h09 antikoerper, wu:fi33d10 antikoerper, 4933417N07Rik antikoerper, AA414968 antikoerper, AL023055 antikoerper, AU018793 antikoerper, AU021806 antikoerper, C85810 antikoerper, Mdmx antikoerper, MDM4, p53 regulator S homeolog antikoerper, MDM4, p53 regulator antikoerper, transformed mouse 3T3 cell double minute 4 antikoerper, mdm4.S antikoerper, MDM4 antikoerper, Mdm4 antikoerper, mdm4 antikoerper

Hintergrund: Protein Mdm4 is a protein that in humans is encoded by the MDM4 gene. This gene encodes a nuclear protein that contains a p53 binding domain at the N-terminus and a RING finger domain at the C-terminus, and shows structural similarity to p53-binding protein MDM2. Both proteins bind the p53 tumor suppressor protein and inhibit its activity, and have been shown to be overexpressed in a variety of human cancers. However, unlike MDM2 which degrades p53, this protein inhibits p53 by binding its transcriptional activation domain. This protein also interacts with MDM2 protein via the RING finger domain, and inhibits the latter's degradation. So this protein can reverse MDM2-targeted degradation of p53, while maintaining suppression of p53 transactivation and apoptotic functions. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.

UniProt: O15151

Pathways: Zellzyklus