Monoamine Oxidase B Antikörper

Produktnummer ABIN4951665

Produktdetails anti-Monoamine Oxidase B Antikörper

Target: Monoamine Oxidase B (MAOB)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Monoamine Oxidase B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity

Immunogen: Amino acids REILHAMGKIPEDEIWQSEPESVDVPAQPITTTFLER of human MAOB were used as the immunogen for the MAOB antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the MAOB antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the MAOB antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu Monoamine Oxidase B

Target: Monoamine Oxidase B (MAOB)

Andere Bezeichnung: Monoamine Oxidase B / MAOB (MAOB Produkte)

Synonyme: MAOB antikoerper, Z-MAO antikoerper, maob antikoerper, moa antikoerper, wu:fb68b05 antikoerper, wu:fo76d11 antikoerper, wu:fq38g06 antikoerper, zgc:85761 antikoerper, MAOA antikoerper, 6330414K01Rik antikoerper, MAO-B antikoerper, monoamine oxidase B antikoerper, amine oxidase [flavin-containing] B antikoerper, monoamine oxidase antikoerper, monoamine oxidase B L homeolog antikoerper, MAOB antikoerper, Gbro_4276 antikoerper, LOC100223232 antikoerper, mao antikoerper, Maob antikoerper, maob.L antikoerper

Hintergrund: Monoamine oxidase B, also called MAO, BRAIN, is a protein that in humans is encoded by the MAOB gene. MAOB is a member of the flavin monoamine oxidase family. And it is mapped on Xp11.3. MAOB catalyzes the oxidative deamination of biogenic and xenobiotic amines and plays an important role in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. This protein preferentially degrades benzylamine and phenylethylamine. Like MAOA, it also degrades dopamine. MAO-B is involved in the breakdown of dopamine, a neurotransmitter implicated in reinforcing and motivating behaviors as well as movement. MAO-B inhibition is, therefore, associated with enhanced activity of dopamine, as well as with decreased production of hydrogen peroxide, a source of reactive oxygen species.

UniProt: P27338