Monoamine Oxidase A Antikörper

Produktnummer ABIN4951664

Produktdetails anti-Monoamine Oxidase A Antikörper

Target: Monoamine Oxidase A (MAOA)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Monoamine Oxidase A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity

Immunogen: Amino acids REVLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWER of human MAOA were used as the immunogen for the MAOA antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the MAOA antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the MAOA antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu Monoamine Oxidase A

Target: Monoamine Oxidase A (MAOA)

Andere Bezeichnung: Monoamine Oxidase A / MAOA (MAOA Produkte)

Synonyme: MAO-A antikoerper, 1110061B18Rik antikoerper, AA407771 antikoerper, Mao antikoerper, MAOA antikoerper, LOC100221249 antikoerper, Z-MAO antikoerper, maob antikoerper, moa antikoerper, wu:fb68b05 antikoerper, wu:fo76d11 antikoerper, wu:fq38g06 antikoerper, zgc:85761 antikoerper, monoamine oxidase A antikoerper, monoamine oxidase A L homeolog antikoerper, amine oxidase [flavin-containing] A antikoerper, monoamine oxidase antikoerper, MAOA antikoerper, Maoa antikoerper, maoa.L antikoerper, mll3668 antikoerper, maoa antikoerper, LOC100221249 antikoerper, mao antikoerper

Hintergrund: Monoamine oxidase A is an enzyme that in humans is encoded by the MAO-A gene. MAOA is an isozyme of monoamine oxidase which is also mapped on Xp11.3. MAOA degrades amine neurotransmitters, such as dopamine, norepinephrine, and serotonin. The protein localizes to the outer mitochondrial membrane. Mutation in MAOA results in monoamine oxidase deficiency, or Brunner syndrome. In humans, there is a 30-base repeat sequence repeated in one of several different numbers of times in the promoter region of the gene coding for MAOA. MAO-A levels in the brain as measured using positron emission tomography are elevated by an average of 34 % in patients with major depressive disorder. Inhibition of MAOA prevented apoptosis, and serum starvation of cortical brain cells from Maoa-deficient mice resulted in reduced apoptosis compared with wildtype mice.

UniProt: P21397