LYZ Antikörper

Produktnummer ABIN4951652

Produktdetails anti-LYZ Antikörper

Target: LYZ (Lysozyme (LYZ))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LYZ Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity

Immunogen: Amino acids NIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQ of human LYZ were used as the immunogen for the Lysozyme antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the Lysozyme antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the Lysozyme antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu LYZ

Target: LYZ (Lysozyme (LYZ))

Andere Bezeichnung: Lysozyme / LYZ (LYZ Produkte)

Synonyme: LZM antikoerper, 1 antikoerper, LYZC antikoerper, lys-C antikoerper, zgc:136734 antikoerper, BmLys antikoerper, LYS antikoerper, LZ antikoerper, LYZS antikoerper, lysozyme C antikoerper, LYZ antikoerper, lysozyme antikoerper, lysozyme antikoerper, lysozyme (renal amyloidosis) antikoerper, lysozyme L homeolog antikoerper, serum lysozyme antikoerper, LYZ antikoerper, lyz antikoerper, Lzm antikoerper, LOC781146 antikoerper, lyz.L antikoerper, S-LZ antikoerper

Hintergrund: In humans, the lysozyme enzyme is encoded by the LYZ gene. This gene encodes human lysozyme, whose natural substrate is the bacterial cell wall peptidoglycan (cleaving the beta [1-4] glycosidic linkages between N-acetylmuramic acid and N-acetylglucosamine). Lysozyme is one of the antimicrobial agents found in human milk, and is also present in spleen, lung, kidney, white blood cells, plasma, saliva, and tears. The protein has antibacterial activity against a number of bacterial species. Missense mutations in this gene have been identified in heritable renal amyloidosis.

UniProt: P61626