LIMK2 Antikörper

Produktnummer ABIN4951617

Produktdetails anti-LIMK2 Antikörper

Target: LIMK2 (LIM Domain Kinase 2 (LIMK2))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LIMK2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity

Immunogen: Amino acids KLEDSFEALSLYLGELGIPLPAELEELDHTVSMQYGLTRD of human LIM Kinase 2 were used as the immunogen for the LIMK2 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the LIMK2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,ELISA : 0.1-0.5 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the LIMK2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu LIMK2

Target: LIMK2 (LIM Domain Kinase 2 (LIMK2))

Andere Bezeichnung: LIM Kinase 2 / LIMK2 (LIMK2 Produkte)

Synonyme: xlimk2 antikoerper, zgc:91990 antikoerper, wu:fa97c09 antikoerper, wu:fk73e11 antikoerper, LIMK2 antikoerper, Limk2b antikoerper, Link2 antikoerper, LIMK antikoerper, 9430059K01 antikoerper, A930024P04Rik antikoerper, C85310 antikoerper, Limk2a antikoerper, LIM domain kinase 2 L homeolog antikoerper, LIM domain kinase 2 antikoerper, LIM motif-containing protein kinase 2 antikoerper, limk2.L antikoerper, limk2 antikoerper, LIMK2 antikoerper, Limk2 antikoerper

Hintergrund: LIM domain kinase 2 is an enzyme that in humans is encoded by the LIMK2 gene. There are approximately 40 known eukaryotic LIM proteins, so named for the LIM domains they contain. LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers. Although zinc fingers usually function by binding to DNA or RNA, the LIM motif probably mediates protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs and a C-terminal protein kinase domain. The protein encoded by this gene is phosphorylated and activated by ROCK, a downstream effector of Rho, and the encoded protein, in turn, phosphorylates cofilin, inhibiting its actin-depolymerizing activity. It is thought that this pathway contributes to Rho-induced reorganization of the actin cytoskeleton. At least three transcript variants encoding different isoforms have been found for this gene.

UniProt: P53671