LIM Domain Kinase 1 Antikörper

Produktnummer ABIN4951616

Produktdetails anti-LIM Domain Kinase 1 Antikörper

Target: LIM Domain Kinase 1 (LIMK1)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LIM Domain Kinase 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity

Immunogen: Amino acids KLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRR of human LIMK1 were used as the immunogen for the LIMK antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the LIMK antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,ELISA : 0.1-0.5 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the LIMK antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu LIM Domain Kinase 1

Target: LIM Domain Kinase 1 (LIMK1)

Andere Bezeichnung: LIM Kinase 1 / LIMK1 (LIMK1 Produkte)

Synonyme: limk1 antikoerper, xlimk1 antikoerper, GB16654 antikoerper, LIMK1 antikoerper, LIMK antikoerper, LIMK-1 antikoerper, LIM domain kinase 1 antikoerper, LIM domain kinase 1a antikoerper, LIM domain kinase 1 L homeolog antikoerper, LIM-domain containing, protein kinase antikoerper, LIMK1 antikoerper, limk1a antikoerper, limk1 antikoerper, CpipJ_CPIJ000717 antikoerper, LOC413152 antikoerper, Limk1 antikoerper, limk1.L antikoerper

Hintergrund: LIM domain kinase 1 is an enzyme that in humans is encoded by the LIMK1 gene. There are approximately 40 known eukaryotic LIM proteins, so named for the LIM domains they contain. LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers. Although zinc fingers usually function by binding to DNA or RNA, the LIM motif probably mediates protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs, a central PDZ domain, and a C-terminal protein kinase domain. LIMK1 is likely to be a component of an intracellular signaling pathway and may be involved in brain development.

UniProt: P53667

Pathways: Caspase Kaskade in der Apoptose, Regulation of Cell Size, CXCR4-mediated Signaling Events