KCNA2 Antikörper

Produktnummer ABIN4951574

Produktdetails anti-KCNA2 Antikörper

Target: KCNA2 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 2 (KCNA2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNA2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity

Immunogen: Amino acids NNSNEDFREENLKTANCTLANTNYVNITKMLTDV of human Kv1.2 were used as the immunogen for the Kv1.2 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the Kv1.2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the Kv1.2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu KCNA2

Target: KCNA2 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 2 (KCNA2))

Andere Bezeichnung: Kv1.2 (KCNA2 Produkte)

Synonyme: KCNA2 antikoerper, kcna2 antikoerper, HBK5 antikoerper, HK4 antikoerper, HUKIV antikoerper, KV1.2 antikoerper, MK2 antikoerper, NGK1 antikoerper, RBK2 antikoerper, Akr6a4 antikoerper, ENSMUSG00000074335 antikoerper, Gm10672 antikoerper, Kca1-2 antikoerper, Kv1.2 antikoerper, Mk-2 antikoerper, BK2 antikoerper, XSha2 antikoerper, k(v)1.2 antikoerper, kcna2-a antikoerper, kv1.2 antikoerper, potassium voltage-gated channel subfamily A member 2 antikoerper, potassium channel, voltage gated shaker related subfamily A, member 1 antikoerper, potassium voltage-gated channel, shaker-related subfamily, member 2 antikoerper, potassium channel, voltage gated shaker related subfamily A, member 2 S homeolog antikoerper, KCNA2 antikoerper, kcna1 antikoerper, Kcna2 antikoerper, LOC100537815 antikoerper, kcna2.S antikoerper

Hintergrund: Potassium voltage-gated channel subfamily A member 2, also known as Kv1.2, is a protein that in humans is encoded by the KCNA2 gene. Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. The coding region of this gene is intronless, and the gene is clustered with genes KCNA3 and KCNA10 on chromosome 1.

UniProt: P16389