HAVCR1 Antikörper

Produktnummer ABIN4951544

Produktdetails anti-HAVCR1 Antikörper

Target: HAVCR1 (Hepatitis A Virus Cellular Receptor 1 (HAVCR1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HAVCR1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity

Immunogen: Amino acids QQLSVSFSSLQIKALQNAVEKEVQAEDNIYIENSLYATD of human HAVCR1 were used as the immunogen for the KIM1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the KIM1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the KIM1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu HAVCR1

Target: HAVCR1 (Hepatitis A Virus Cellular Receptor 1 (HAVCR1))

Andere Bezeichnung: KIM-1 / TIM-1 / HAVCR1 (HAVCR1 Produkte)

Synonyme: HAVCR antikoerper, HAVCR-1 antikoerper, KIM-1 antikoerper, KIM1 antikoerper, TIM antikoerper, TIM-1 antikoerper, TIM1 antikoerper, TIMD-1 antikoerper, TIMD1 antikoerper, Kim1 antikoerper, HAVCR1 antikoerper, LOC100226241 antikoerper, AI503787 antikoerper, Tim1 antikoerper, Timd1 antikoerper, hepatitis A virus cellular receptor 1 antikoerper, hepatitis A virus cellular receptor 1 homolog antikoerper, HAVCR1 antikoerper, Havcr1 antikoerper, LOC100226241 antikoerper

Substanzklasse: Virus

Hintergrund: Kidney injury molecule 1, also known as HAVCR1, HAVCR or TIM1, is a protein that in humans is encoded by the HAVCR1 gene. It may play a role in T-helper cell development and the regulation of asthma and allergic diseases. Receptor for TIMD4 (By similarity). May play a role in kidney injury and repair. [UniProt]

UniProt: Q96D42