KCNA3 Antikörper

Produktnummer ABIN4951520

Produktdetails anti-KCNA3 Antikörper

Target: KCNA3 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 3 (KCNA3))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNA3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity

Immunogen: Amino acids EELRKARSNSTLSKSEYMVIEEGGMNHSAFPQ of human KCNA3 were used as the immunogen for the KCNA3 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the KCNA3 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the KCNA3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu KCNA3

Target: KCNA3 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 3 (KCNA3))

Andere Bezeichnung: KCNA3 / Kv1.3 (KCNA3 Produkte)

Synonyme: Kv1.3-glyb antikoerper, kv1.3 antikoerper, Kv1.3B antikoerper, kcna3b-a antikoerper, HGK5 antikoerper, HLK3 antikoerper, HPCN3 antikoerper, HUKIII antikoerper, KV1.3 antikoerper, MK3 antikoerper, PCN3 antikoerper, Kca1-3 antikoerper, Kv1.3 antikoerper, Mk-3 antikoerper, cKv1.1 antikoerper, potassium voltage-gated channel subfamily A member 3 antikoerper, potassium channel, voltage gated shaker related subfamily A, member 3 S homeolog antikoerper, potassium voltage-gated channel, shaker-related subfamily, member 3 antikoerper, KCNA3 antikoerper, kcna3.S antikoerper, Kcna3 antikoerper

Hintergrund: Potassium voltage-gated channel, shaker-related subfamily, member 3, also known as KCNA3 or Kv1.3, is a protein that in humans is encoded by the KCNA3 gene. This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. It plays an essential role in T-cell proliferation and activation. This gene appears to be intronless and it is clustered together with KCNA2 and KCNA10 genes on chromosome 1. And Kv1.3 has been reported to be expressed in the inner mitochondrial membrane in lymphocytes. The apoptotic protein Bax has been suggested to insert into theouter mitochondrial membrane and occlude the pore of Kv1.3 via a lysine residue. Thus, Kv1.3 modulation may be one of many mechanisms that contribute to apoptosis.

UniProt: P22001