IDH1 Antikörper

Produktnummer ABIN4951400

Produktdetails anti-IDH1 Antikörper

Target: IDH1 (Isocitrate Dehydrogenase 1 (NADP+), Soluble (IDH1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IDH1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunohistochemistry (Frozen Sections) (IHC (fro))

Aufreinigung: Antigen affinity

Immunogen: Amino acids KGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAK of human IDH1 were used as the immunogen for the IDH1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the IDH1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL,IHC (Frozen): 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the IDH1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu IDH1

Target: IDH1 (Isocitrate Dehydrogenase 1 (NADP+), Soluble (IDH1))

Andere Bezeichnung: IDH1 (IDH1 Produkte)

Synonyme: IDCD antikoerper, IDH antikoerper, IDP antikoerper, IDPC antikoerper, PICD antikoerper, NADP-CICDH antikoerper, AI314845 antikoerper, AI788952 antikoerper, E030024J03Rik antikoerper, Id-1 antikoerper, Idh-1 antikoerper, Idpc antikoerper, cb876 antikoerper, fm90e09 antikoerper, im:7143416 antikoerper, wu:fm90e09 antikoerper, F23E12.180 antikoerper, F23E12_180 antikoerper, IDH-I antikoerper, NAD+ DEPENDENT ISOCITRATE DEHYDROGENASE SUBUNIT 1 antikoerper, isocitrate dehydrogenase 1 antikoerper, isocitrate dehydrogenase I antikoerper, isocitrate dehydrogenase (NADP(+)) 1, cytosolic antikoerper, isocitrate dehydrogenase 1 (NADP+), soluble antikoerper, isocitrate dehydrogenase 1 (NADP+) L homeolog antikoerper, isocitrate dehydrogenase 1 antikoerper, IDH1 antikoerper, Idh1 antikoerper, idh1.L antikoerper, idh1 antikoerper

Hintergrund: Isocitrate dehydrogenase 1 (NADP+), soluble is an enzyme that in humans is encoded by the IDH1 gene. Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the cytoplasm and peroxisomes. It contains the PTS-1 peroxisomal targeting signal sequence. The presence of this enzyme in peroxisomes suggests roles in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the alpha-hydroxylation of phytanic acid. The cytoplasmic enzyme serves a significant role in cytoplasmic NADPH production. Alternatively spliced transcript variants encoding the same protein have been found for this gene.

UniProt: O75874

Pathways: Warburg Effekt