HMGB3 Antikörper

Produktnummer ABIN4951316

Produktdetails anti-HMGB3 Antikörper

Target: HMGB3 (High Mobility Group Box 3 (HMGB3))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HMGB3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity

Immunogen: Amino acids EMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKR of human HMG4 were used as the immunogen for the HMG4 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the HMG4 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the HMG4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu HMGB3

Target: HMGB3 (High Mobility Group Box 3 (HMGB3))

Andere Bezeichnung: HMGB3 / HMG4 (HMGB3 Produkte)

Synonyme: HMG-2a antikoerper, HMG-4 antikoerper, HMG2A antikoerper, HMG4 antikoerper, Hmg2a antikoerper, Hmg4 antikoerper, RGD1564407 antikoerper, hmgb3 antikoerper, MGC54022 antikoerper, Xhmgb3 antikoerper, MGC88931 antikoerper, fa19b06 antikoerper, fj43d02 antikoerper, wu:fa19b06 antikoerper, wu:fj43d02 antikoerper, zgc:112073 antikoerper, HMGB3 antikoerper, NFD03 antikoerper, NFD3 antikoerper, NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR antikoerper, high mobility group B3 antikoerper, HMG-1 antikoerper, HMG2a antikoerper, HMGB1 antikoerper, high mobility group box 3 antikoerper, high mobility group box 3b antikoerper, high mobility group box 3 S homeolog antikoerper, high mobility group protein antikoerper, high mobility group B3 antikoerper, High mobility group protein B3 antikoerper, HMGB3 antikoerper, Hmgb3 antikoerper, hmgb3 antikoerper, hmgb3b antikoerper, hmgb3.S antikoerper

Hintergrund: High-mobility group protein B, also known as HMG4, is a protein that in humans is encoded by the HMGB3 gene. This gene encodes a member of a family of proteins containing one or more high mobility group DNA-binding motifs. The encoded protein plays an important role in maintaining stem cell populations, and may be aberrantly expressed in tumor cells. A mutation in this gene was associated with microphthalmia, syndromic 13. There are numerous pseudogenes of this gene on multiple chromosomes. Alternative splicing results in multiple transcript variants.

UniProt: O15347