HDAC6 Antikörper

Produktnummer ABIN4951283

Produktdetails anti-HDAC6 Antikörper

Target: HDAC6 (Histone Deacetylase 6 (HDAC6))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HDAC6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity

Immunogen: Amino acids EKEELMLVHSLEYIDLMETTQYMNEGELRVLAD of human HDAC6 were used as the immunogen for the HDAC6 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the HDAC6 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the HDAC6 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu HDAC6

Target: HDAC6 (Histone Deacetylase 6 (HDAC6))

Andere Bezeichnung: HDAC6 (HDAC6 Produkte)

Synonyme: HD6 antikoerper, Hd6 antikoerper, Hdac5 antikoerper, Sfc6 antikoerper, mHDA2 antikoerper, CG6170 antikoerper, DHDAC2 antikoerper, DmHDAC2 antikoerper, Dmel\\CG6170 antikoerper, HDAC antikoerper, HDAC2 antikoerper, dHDAC2 antikoerper, dHDAC6 antikoerper, dmHDA404 antikoerper, hdac6 antikoerper, MGC53140 antikoerper, wu:fc31d02 antikoerper, dsim_GLEANR_17355 antikoerper, DsimGD17207 antikoerper, GD17207 antikoerper, HDAC6 antikoerper, ATHDA6 antikoerper, AXE1 antikoerper, HISTONE DEACETYLASE 6 antikoerper, MDC12.7 antikoerper, MDC12_7 antikoerper, RNA-MEDIATED TRANSCRIPTIONAL SILENCING 1 antikoerper, RPD3B antikoerper, RTS1 antikoerper, SIL1 antikoerper, histone deacetylase 6 antikoerper, histone deacetylase 6 antikoerper, Histone deacetylase 6 antikoerper, histone deacetylase 6 L homeolog antikoerper, GD17207 gene product from transcript GD17207-RB antikoerper, Histone DeAcetylase antikoerper, HDAC6 antikoerper, Hdac6 antikoerper, hdac6.L antikoerper, hdac6 antikoerper, Dsim\HDAC6 antikoerper, PTRG_03035 antikoerper, HDA6 antikoerper, hda-6 antikoerper

Hintergrund: HDAC6, also called KIAA0901, is a member belongs to class II of the histone deacetylase/acuc/apha family of proteins that is an enzyme that in humans is encoded by the HDAC6 gene. The HDAC6 gene is mapped to chromosome Xp11.23. HDAC6 contains an internal duplication of two catalytic domains which appear to function independently of each other. The protein possesses histone deacetylase activity and represses transcription. HDAC6 functions as a tubulin deacetylase. And it is localized exclusively in the cytoplasm, where it associates with microtubules and localizes with the microtubule motor complex. HDAC6 could bind both polyubiquitinated misfolded proteins and dynein motors, thereby recruiting misfolded protein cargo to dynein motors for transport to aggresomes. Furthermore, expression of HDAC6 was sufficient to rescue degeneration associated with UPS dysfunction in vivo in an autophagy-dependent manner. HDAC6 is a central component of the stress response that regulates SG formation and potentially contributes to control of RNA metabolism and translation.

UniProt: Q9UBN7

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling