GRP78 Antikörper

Produktnummer ABIN4951256

Produktdetails anti-GRP78 Antikörper

Target: GRP78 (HSPA5) (Heat Shock 70kDa Protein 5 (Glucose-Regulated Protein, 78kDa) (HSPA5))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GRP78 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity

Immunogen: Amino acids ETMEKAVEEKIEWLESHQDADIEDFKAKKKELE of human GRP78/BiP were used as the immunogen for the GRP78 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the GRP78 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the GRP78 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu GRP78

Target: GRP78 (HSPA5) (Heat Shock 70kDa Protein 5 (Glucose-Regulated Protein, 78kDa) (HSPA5))

Andere Bezeichnung: GRP78 / BiP (HSPA5 Produkte)

Synonyme: GRP78 antikoerper, BiP antikoerper, GRP-78 antikoerper, grp78 antikoerper, hspa5a antikoerper, BIP antikoerper, MIF2 antikoerper, AL022860 antikoerper, AU019543 antikoerper, Bip antikoerper, D2Wsu141e antikoerper, D2Wsu17e antikoerper, Grp78 antikoerper, Hsce70 antikoerper, SEZ-7 antikoerper, Sez7 antikoerper, baffled antikoerper, mBiP antikoerper, cb865 antikoerper, fb60h09 antikoerper, fi36d04 antikoerper, wu:fb60h09 antikoerper, wu:fi36d04 antikoerper, zgc:55994 antikoerper, zgc:77606 antikoerper, 78 kDa glucose-regulated protein antikoerper, heat shock protein family A (Hsp70) member 5 antikoerper, BiP/GRP78 antikoerper, glucose-regulated protein 78 antikoerper, putative glucose-regulated protein 78 antikoerper, Hsp70 family ATPase KAR2 antikoerper, heat shock protein family A (Hsp70) member 5 S homeolog antikoerper, heat shock 70 kDa protein 5a antikoerper, heat shock 70kDa protein 5 (glucose-regulated protein, 78kDa) antikoerper, heat shock protein 5 antikoerper, heat shock protein family A member 5 antikoerper, CpipJ_CPIJ003550 antikoerper, HSPA5 antikoerper, grp78 antikoerper, LOC100533358 antikoerper, BiP/grp78 antikoerper, Tc00.1047053506585.40 antikoerper, Tb11.02.5450 antikoerper, Tb11.02.5500 antikoerper, LMJF_28_1200 antikoerper, KAR2 antikoerper, LOC100135840 antikoerper, hspa5.S antikoerper, hspa5 antikoerper, Hspa5 antikoerper

Hintergrund: HSPA5 (heat shock 70 kDa protein 5), also known as glucose-regulated protein, 78kD (GRP78) or BiP, is a member of the heat-shock protein-70 (HSP70) family and is involved in the folding and assembly of proteins in the endoplasmic reticulum. BiP is also an essential component of the translocation machinery, as well as playing a role in retrograde transport across the ER membrane of aberrant proteins destined for degradation by the proteasome. The HSPA5 gene is mapped on 9q33.3. Shen et al. (2002) concluded that HSPA5 retains ATF6 in the ER by inhibiting its Golgi localization signals and that dissociation of HSPA5 during ER stress allows ATF6 to be transported to the Golgi. The findings of Shen et al. (2002) demonstrated that HSPA5 is a key element in sensing the folding capacity within the ER.

UniProt: P11021

Pathways: Thyroid Hormone Synthesis, ER-Nucleus Signaling