HSPA9 Antikörper

Produktnummer ABIN4951254

Produktdetails anti-HSPA9 Antikörper

Target: HSPA9 (Heat Shock 70kDa Protein 9 (Mortalin) (HSPA9))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HSPA9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity

Immunogen: Amino acids KLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ of human HSPA9/GRP75 were used as the immunogen for the GRP75 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the GRP75 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the GRP75 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu HSPA9

Target: HSPA9 (Heat Shock 70kDa Protein 9 (Mortalin) (HSPA9))

Andere Bezeichnung: GRP75 (HSPA9 Produkte)

Synonyme: APG-2 antikoerper, HS24/P52 antikoerper, HSPH2 antikoerper, RY antikoerper, hsp70 antikoerper, hsp70RY antikoerper, CSA antikoerper, GRP-75 antikoerper, GRP75 antikoerper, HSPA9B antikoerper, MOT antikoerper, MOT2 antikoerper, MTHSP75 antikoerper, PBP74 antikoerper, Hspa9a antikoerper, csa antikoerper, grp-75 antikoerper, grp75 antikoerper, hspa9 antikoerper, hspa9b antikoerper, mortalin antikoerper, mot antikoerper, mot2 antikoerper, pbp74 antikoerper, mot-2 antikoerper, mthsp75 antikoerper, 74kDa antikoerper, Csa antikoerper, Grp75 antikoerper, Hsc74 antikoerper, Hsp74 antikoerper, Hsp74a antikoerper, Mortalin antikoerper, Mot-2 antikoerper, Mot2 antikoerper, Mthsp70 antikoerper, Pbp74 antikoerper, cb740 antikoerper, crs antikoerper, wu:fc14d08 antikoerper, wu:fc27c10 antikoerper, wu:fc38a06 antikoerper, heat shock protein family A (Hsp70) member 4 antikoerper, heat shock protein family A (Hsp70) member 9 antikoerper, heat shock protein family A member 9 antikoerper, heat shock protein family A (Hsp70) member 9 S homeolog antikoerper, stress-70 protein, mitochondrial antikoerper, heat shock protein 9 antikoerper, heat shock protein Hsp9 antikoerper, HSPA4 antikoerper, HSPA9 antikoerper, Hspa9 antikoerper, hspa9.S antikoerper, hspa9 antikoerper, LOC577721 antikoerper, hsp9 antikoerper

Hintergrund: HSPA9 (heat shock 70 kDa protein 9 (mortalin)), also known as GRP75, mot-2, mthsp75, PBP74, HSPA9B, MORTALIN or MORTALIN, PERINUCLEAR, is a highly conserved member of the HSP70 family of proteins. It functions as a chaperone in the mitochondria, cytoplasm, and centrosome. The HSPA9 gene is mapped to chromosome 5q31.2 based on an alignment of the HSPA9 sequence with the genomic sequence. Knockdown of HSPA9 in erythroid cultures was associated with an increased number of cells in the G0/G1 phase of the cell cycle and accelerated apoptosis. Knockdown of Hspa9 in mouse bone marrow cells, followed by transplantation into wildtype recipients, also resulted in loss of erythroid cell number. Haploinsufficiency for HSPA9 may contribute to abnormal hematopoiesis in myelodysplastic syndromes. This protein plays a role in the control of cell proliferation.

UniProt: P38646