GRK6 Antikörper

Produktnummer ABIN4951250

Produktdetails anti-GRK6 Antikörper

Target: GRK6 (G Protein-Coupled Receptor Kinase 6 (GRK6))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GRK6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity

Immunogen: Amino acids QSPFQQRKKKIKREEVERLVKEVPEEYSERFSPQAR of human GRK6 were used as the immunogen for the GRK6 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the GRK6 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the GRK6 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu GRK6

Target: GRK6 (G Protein-Coupled Receptor Kinase 6 (GRK6))

Andere Bezeichnung: GRK6 (GRK6 Produkte)

Synonyme: MGC83187 antikoerper, GRK6 antikoerper, GPRK6 antikoerper, Gprk6 antikoerper, G protein-coupled receptor kinase 6 antikoerper, G protein-coupled receptor kinase 6 S homeolog antikoerper, GRK6 antikoerper, grk6.S antikoerper, grk6 antikoerper, Grk6 antikoerper

Hintergrund: G protein-coupled receptor kinase 6 is an enzyme that in humans is encoded by the GRK6 gene. It is mapped to 5q35. This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. Several transcript variants encoding different isoforms have been described for this gene. Also, GRK6 appears to be involved in responses tomorphine.

UniProt: P43250

Pathways: Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling, CXCR4-mediated Signaling Events, Negative Regulation of Transporter Activity